Prediction Results are written below.
(All scores are on a 0 to 1 scale. Guide to interpret numbers are shown after prediction scores)

Scores higher than and equal to 0.8 have been highlighted by red color.


Predicted scores for binding to single nucleotides:

Residue Ade Cyt Gua Thy
A 0.19 0.28 0.15 0.39
C 0.24 0.29 0.18 0.33
G 0.22 0.33 0.22 0.34
L 0.04 0.05 0.02 0.13
V 0.09 0.07 0.04 0.10
A 0.06 0.14 0.05 0.25
S 0.55 0.45 0.46 0.42
N 0.71 0.50 0.53 0.33
L 0.06 0.07 0.03 0.15
N 0.50 0.39 0.40 0.33
L 0.22 0.11 0.10 0.07
K 0.96 0.91 0.96 0.77
P 0.04 0.09 0.02 0.45
G 0.33 0.37 0.31 0.28
E 0.84 0.82 0.87 0.72
C 0.87 0.66 0.76 0.67
L 0.08 0.14 0.07 0.22
R 0.66 0.64 0.59 0.56
V 0.44 0.47 0.32 0.25
R 0.93 0.78 0.85 0.83
G 0.50 0.58 0.34 0.73
E 0.73 0.66 0.67 0.71
V 0.26 0.20 0.15 0.09
A 0.29 0.41 0.25 0.60
A 0.20 0.23 0.14 0.20
D 0.80 0.62 0.72 0.61
A 0.20 0.27 0.15 0.38
K 0.90 0.83 0.90 0.70
S 0.91 0.76 0.80 0.74
F 0.86 0.68 0.75 0.71
L 0.20 0.33 0.16 0.37
L 0.03 0.07 0.01 0.05
N 0.52 0.56 0.31 0.83
L 0.28 0.25 0.18 0.16
G 0.39 0.46 0.42 0.26
K 0.62 0.57 0.47 0.34
D 0.20 0.30 0.19 0.06
D 0.25 0.26 0.17 0.24
N 0.09 0.14 0.07 0.22
N 0.04 0.05 0.02 0.11
L 0.14 0.19 0.13 0.06
C 0.15 0.22 0.10 0.37
N 0.51 0.49 0.44 0.39
P 0.81 0.60 0.62 0.46
R 0.93 0.77 0.85 0.79
F 0.47 0.48 0.21 0.77
N 0.26 0.36 0.18 0.44
A 0.17 0.21 0.14 0.08
H 0.30 0.18 0.15 0.13
G 0.06 0.08 0.04 0.13
D 0.32 0.41 0.30 0.39
V 0.22 0.26 0.17 0.17
N 0.94 0.88 0.93 0.78
T 0.42 0.42 0.34 0.57
I 0.11 0.17 0.05 0.20
V 0.12 0.28 0.06 0.40
C 0.72 0.75 0.54 0.89
N 0.49 0.58 0.36 0.78
S 0.75 0.70 0.59 0.82
K 0.77 0.55 0.65 0.47
D 0.04 0.07 0.03 0.07
A 0.27 0.35 0.15 0.35
G 0.22 0.27 0.23 0.07
A 0.84 0.80 0.85 0.78
W 0.82 0.51 0.62 0.54
G 0.53 0.69 0.63 0.82
A 0.36 0.35 0.31 0.70
E 0.52 0.36 0.36 0.32
Q 0.30 0.35 0.31 0.58
R 0.73 0.53 0.57 0.55
E 0.35 0.49 0.25 0.68
S 0.71 0.68 0.69 0.45
A 0.27 0.31 0.19 0.47
F 0.23 0.25 0.15 0.37
P 0.80 0.66 0.64 0.83
F 0.68 0.56 0.52 0.74
Q 0.96 0.94 0.97 0.80
P 0.72 0.45 0.46 0.48
G 0.20 0.35 0.19 0.69
S 0.21 0.32 0.20 0.66
V 0.05 0.09 0.04 0.20
V 0.03 0.04 0.01 0.17
E 0.02 0.05 0.01 0.21
V 0.01 0.04 0.00 0.07
F 0.01 0.03 0.00 0.13
N 0.02 0.04 0.01 0.11
Q 0.07 0.10 0.05 0.06
T 0.07 0.13 0.05 0.27
D 0.08 0.09 0.04 0.31
L 0.08 0.12 0.05 0.26
T 0.19 0.23 0.08 0.36
I 0.02 0.04 0.01 0.16
K 0.04 0.16 0.02 0.49
L 0.01 0.06 0.01 0.18
P 0.28 0.29 0.14 0.28
D 0.21 0.19 0.13 0.14
G 0.51 0.52 0.46 0.32
Y 0.07 0.09 0.02 0.19
E 0.03 0.04 0.01 0.12
F 0.03 0.07 0.02 0.15
K 0.50 0.54 0.24 0.87
F 0.30 0.43 0.15 0.43
P 0.77 0.78 0.79 0.92
N 0.57 0.60 0.42 0.58
R 0.87 0.76 0.73 0.86
L 0.15 0.21 0.04 0.45
N 0.18 0.32 0.11 0.42
L 0.04 0.05 0.02 0.14
E 0.11 0.10 0.05 0.09
A 0.26 0.20 0.13 0.15
I 0.07 0.20 0.08 0.07
N 0.73 0.58 0.59 0.72
Y 0.39 0.43 0.33 0.14
L 0.19 0.14 0.08 0.38
S 0.15 0.31 0.11 0.19
A 0.05 0.08 0.03 0.11
G 0.24 0.47 0.28 0.22
G 0.25 0.31 0.21 0.14
D 0.69 0.56 0.60 0.54
F 0.05 0.09 0.04 0.12
K 0.81 0.72 0.60 0.90
I 0.15 0.29 0.09 0.14
K 0.92 0.78 0.86 0.79
C 0.69 0.61 0.62 0.25
V 0.16 0.24 0.12 0.35
A 0.52 0.58 0.48 0.56
F 0.09 0.12 0.04 0.13
E 0.14 0.15 0.08 0.22

Predicted scores for binding to unique dinucleotide steps:

ResidueAA/TTAC/GTAG/CTAT/ATCA/TGCC/GGCG/CGGA/TCGC/GCTA/TA
A 0.52 0.53 0.43 0.31 0.33 0.56 0.24 0.11 0.40 0.23
C 0.63 0.61 0.61 0.52 0.60 0.76 0.56 0.40 0.71 0.36
G 0.40 0.41 0.58 0.47 0.25 0.52 0.39 0.24 0.38 0.38
L 0.10 0.18 0.07 0.19 0.08 0.16 0.11 0.08 0.10 0.19
V 0.18 0.13 0.25 0.13 0.09 0.19 0.17 0.11 0.13 0.29
A 0.14 0.11 0.05 0.03 0.05 0.08 0.03 0.02 0.05 0.13
S 0.35 0.26 0.41 0.35 0.21 0.29 0.35 0.30 0.33 0.45
N 0.29 0.48 0.34 0.77 0.59 0.66 0.77 0.82 0.68 0.56
L 0.36 0.22 0.23 0.06 0.22 0.20 0.14 0.13 0.09 0.33
N 0.38 0.26 0.50 0.27 0.24 0.36 0.36 0.28 0.31 0.42
L 0.45 0.18 0.23 0.09 0.31 0.15 0.25 0.34 0.21 0.50
K 0.70 0.48 0.79 0.42 0.58 0.61 0.62 0.60 0.54 0.63
P 0.25 0.18 0.19 0.33 0.43 0.34 0.61 0.72 0.54 0.49
G 0.67 0.53 0.71 0.48 0.29 0.44 0.31 0.18 0.41 0.45
E 0.74 0.54 0.75 0.34 0.54 0.53 0.46 0.43 0.39 0.60
C 0.59 0.28 0.61 0.28 0.33 0.31 0.42 0.40 0.41 0.56
L 0.16 0.14 0.08 0.09 0.14 0.13 0.13 0.13 0.10 0.25
R 0.10 0.15 0.13 0.39 0.14 0.29 0.36 0.29 0.33 0.25
V 0.68 0.69 0.53 0.77 0.70 0.55 0.68 0.79 0.68 0.73
R 0.79 0.65 0.83 0.86 0.81 0.81 0.90 0.90 0.93 0.71
G 0.59 0.58 0.48 0.72 0.69 0.61 0.73 0.78 0.75 0.62
E 0.81 0.65 0.86 0.76 0.76 0.77 0.83 0.83 0.86 0.71
V 0.37 0.36 0.27 0.30 0.39 0.42 0.37 0.34 0.35 0.35
A 0.56 0.46 0.28 0.73 0.44 0.57 0.64 0.70 0.84 0.78
A 0.32 0.18 0.33 0.12 0.31 0.29 0.36 0.41 0.21 0.46
D 0.74 0.36 0.77 0.25 0.62 0.48 0.62 0.69 0.50 0.69
A 0.59 0.45 0.55 0.33 0.66 0.70 0.62 0.57 0.68 0.43
K 0.92 0.78 0.96 0.81 0.85 0.85 0.88 0.86 0.89 0.80
S 0.59 0.47 0.59 0.75 0.77 0.70 0.88 0.91 0.88 0.67
F 0.46 0.46 0.43 0.50 0.57 0.61 0.61 0.59 0.58 0.44
L 0.55 0.59 0.44 0.50 0.62 0.69 0.54 0.48 0.64 0.41
L 0.11 0.09 0.04 0.11 0.06 0.05 0.09 0.09 0.10 0.26
N 0.63 0.57 0.58 0.78 0.70 0.69 0.80 0.81 0.86 0.59
L 0.34 0.16 0.12 0.12 0.25 0.11 0.22 0.32 0.23 0.45
G 0.55 0.65 0.52 0.58 0.57 0.59 0.51 0.54 0.41 0.58
K 0.23 0.23 0.24 0.40 0.50 0.50 0.69 0.76 0.56 0.47
D 0.28 0.42 0.25 0.69 0.54 0.61 0.70 0.73 0.69 0.43
D 0.24 0.22 0.25 0.16 0.19 0.27 0.22 0.18 0.16 0.31
N 0.20 0.18 0.20 0.16 0.14 0.29 0.20 0.12 0.26 0.21
N 0.09 0.06 0.07 0.02 0.03 0.04 0.03 0.02 0.02 0.17
L 0.14 0.08 0.07 0.02 0.07 0.06 0.05 0.05 0.02 0.23
C 0.33 0.18 0.10 0.03 0.30 0.19 0.13 0.15 0.14 0.26
N 0.53 0.46 0.63 0.66 0.34 0.50 0.53 0.43 0.61 0.52
P 0.62 0.56 0.68 0.80 0.73 0.74 0.85 0.87 0.87 0.65
R 0.78 0.61 0.80 0.82 0.83 0.78 0.90 0.92 0.92 0.73
F 0.43 0.23 0.19 0.24 0.46 0.22 0.45 0.61 0.45 0.55
N 0.56 0.53 0.55 0.77 0.67 0.70 0.80 0.80 0.85 0.55
A 0.18 0.16 0.13 0.09 0.09 0.18 0.09 0.05 0.13 0.17
H 0.48 0.26 0.52 0.22 0.42 0.39 0.49 0.52 0.38 0.53
G 0.08 0.07 0.09 0.04 0.03 0.07 0.05 0.03 0.03 0.17
D 0.46 0.33 0.34 0.27 0.38 0.34 0.37 0.37 0.36 0.43
V 0.11 0.09 0.16 0.11 0.07 0.15 0.16 0.12 0.10 0.26
N 0.84 0.56 0.83 0.36 0.63 0.55 0.54 0.53 0.53 0.67
T 0.50 0.41 0.62 0.35 0.41 0.57 0.47 0.37 0.40 0.43
I 0.49 0.37 0.26 0.37 0.48 0.32 0.44 0.53 0.49 0.51
V 0.29 0.34 0.16 0.46 0.45 0.42 0.50 0.53 0.53 0.36
C 0.66 0.71 0.72 0.93 0.69 0.75 0.85 0.86 0.89 0.71
N 0.75 0.68 0.63 0.77 0.74 0.64 0.74 0.77 0.81 0.67
S 0.48 0.51 0.53 0.80 0.46 0.60 0.68 0.61 0.76 0.51
K 0.61 0.23 0.53 0.09 0.42 0.25 0.34 0.43 0.21 0.60
D 0.16 0.13 0.06 0.07 0.22 0.14 0.18 0.25 0.11 0.29
A 0.05 0.08 0.04 0.26 0.15 0.20 0.39 0.45 0.29 0.25
G 0.56 0.52 0.54 0.31 0.47 0.50 0.37 0.35 0.27 0.49
A 0.55 0.51 0.53 0.74 0.34 0.63 0.58 0.48 0.75 0.64
W 0.82 0.70 0.86 0.88 0.85 0.84 0.92 0.92 0.94 0.73
G 0.76 0.78 0.79 0.67 0.64 0.66 0.55 0.56 0.43 0.72
A 0.78 0.60 0.90 0.66 0.45 0.65 0.59 0.42 0.65 0.60
E 0.77 0.53 0.76 0.27 0.49 0.50 0.38 0.31 0.37 0.53
Q 0.70 0.50 0.65 0.59 0.66 0.48 0.70 0.81 0.66 0.77
R 0.56 0.45 0.57 0.67 0.71 0.68 0.82 0.85 0.82 0.60
E 0.55 0.38 0.44 0.58 0.68 0.53 0.78 0.85 0.78 0.64
S 0.42 0.25 0.44 0.16 0.43 0.39 0.45 0.51 0.27 0.52
A 0.39 0.23 0.42 0.19 0.44 0.43 0.51 0.56 0.35 0.49
F 0.50 0.38 0.47 0.20 0.41 0.45 0.34 0.29 0.26 0.40
P 0.63 0.51 0.68 0.79 0.66 0.69 0.82 0.82 0.87 0.62
F 0.63 0.47 0.50 0.62 0.66 0.49 0.72 0.81 0.73 0.69
Q 0.90 0.85 0.93 0.86 0.83 0.81 0.82 0.84 0.81 0.84
P 0.71 0.33 0.71 0.32 0.59 0.44 0.65 0.73 0.60 0.70
G 0.30 0.36 0.21 0.38 0.46 0.48 0.48 0.48 0.44 0.34
S 0.49 0.40 0.47 0.21 0.32 0.41 0.26 0.19 0.22 0.37
V 0.14 0.09 0.03 0.22 0.03 0.07 0.10 0.12 0.27 0.59
V 0.08 0.05 0.05 0.02 0.02 0.03 0.02 0.02 0.01 0.15
E 0.04 0.05 0.01 0.06 0.06 0.05 0.09 0.11 0.07 0.16
V 0.02 0.04 0.01 0.06 0.02 0.03 0.05 0.04 0.04 0.10
F 0.02 0.04 0.01 0.05 0.02 0.03 0.04 0.04 0.03 0.11
N 0.02 0.04 0.01 0.06 0.03 0.04 0.05 0.05 0.04 0.10
Q 0.05 0.05 0.03 0.03 0.03 0.04 0.03 0.03 0.02 0.15
T 0.13 0.07 0.07 0.02 0.06 0.06 0.05 0.05 0.03 0.22
D 0.11 0.08 0.14 0.09 0.08 0.14 0.16 0.13 0.10 0.25
L 0.08 0.06 0.05 0.02 0.02 0.03 0.02 0.02 0.01 0.16
T 0.11 0.11 0.06 0.23 0.37 0.25 0.55 0.71 0.41 0.38
I 0.07 0.07 0.02 0.04 0.13 0.07 0.12 0.19 0.07 0.23
K 0.07 0.09 0.02 0.11 0.20 0.13 0.25 0.37 0.18 0.24
L 0.02 0.05 0.01 0.09 0.03 0.05 0.07 0.07 0.05 0.12
P 0.20 0.21 0.16 0.40 0.34 0.32 0.53 0.59 0.49 0.41
D 0.46 0.44 0.55 0.75 0.46 0.59 0.70 0.64 0.75 0.51
G 0.19 0.13 0.18 0.11 0.20 0.22 0.26 0.28 0.15 0.35
Y 0.06 0.08 0.02 0.09 0.17 0.11 0.21 0.32 0.14 0.23
E 0.10 0.07 0.07 0.03 0.06 0.07 0.07 0.06 0.04 0.21
F 0.06 0.06 0.02 0.03 0.08 0.05 0.07 0.10 0.04 0.19
K 0.27 0.18 0.19 0.40 0.44 0.32 0.65 0.76 0.62 0.52
F 0.47 0.42 0.27 0.55 0.58 0.34 0.61 0.79 0.55 0.70
P 0.76 0.59 0.85 0.58 0.69 0.76 0.73 0.68 0.71 0.62
N 0.71 0.59 0.66 0.77 0.77 0.64 0.83 0.90 0.83 0.77
R 0.78 0.72 0.80 0.91 0.86 0.84 0.92 0.94 0.94 0.75
L 0.16 0.14 0.05 0.15 0.30 0.14 0.31 0.49 0.23 0.39
N 0.10 0.17 0.09 0.47 0.31 0.40 0.58 0.61 0.53 0.29
L 0.08 0.06 0.06 0.03 0.02 0.04 0.03 0.02 0.02 0.16
E 0.25 0.15 0.13 0.06 0.22 0.15 0.15 0.19 0.09 0.33
A 0.13 0.10 0.17 0.13 0.11 0.19 0.23 0.20 0.15 0.29
I 0.02 0.04 0.01 0.06 0.04 0.05 0.07 0.07 0.05 0.13
N 0.33 0.39 0.33 0.63 0.23 0.41 0.40 0.27 0.54 0.33
Y 0.13 0.14 0.10 0.21 0.24 0.25 0.37 0.42 0.28 0.31
L 0.17 0.11 0.06 0.05 0.20 0.11 0.14 0.21 0.08 0.30
S 0.06 0.09 0.05 0.22 0.10 0.16 0.26 0.27 0.21 0.25
A 0.08 0.06 0.05 0.03 0.03 0.04 0.03 0.02 0.02 0.17
G 0.10 0.19 0.07 0.32 0.16 0.24 0.27 0.23 0.25 0.23
G 0.22 0.21 0.16 0.17 0.26 0.22 0.27 0.36 0.14 0.45
D 0.52 0.33 0.66 0.40 0.27 0.39 0.42 0.32 0.43 0.50
F 0.15 0.09 0.01 0.09 0.02 0.03 0.03 0.03 0.10 0.53
K 0.55 0.42 0.56 0.73 0.60 0.59 0.79 0.80 0.84 0.61
I 0.11 0.12 0.03 0.13 0.26 0.14 0.27 0.42 0.20 0.32
K 0.73 0.63 0.79 0.79 0.78 0.81 0.86 0.86 0.87 0.65
C 0.47 0.26 0.47 0.21 0.50 0.41 0.56 0.65 0.38 0.59
V 0.49 0.47 0.46 0.32 0.46 0.52 0.40 0.36 0.32 0.43
A 0.62 0.62 0.69 0.65 0.65 0.83 0.70 0.53 0.82 0.37
F 0.29 0.22 0.15 0.26 0.22 0.17 0.25 0.27 0.29 0.39
E 0.21 0.23 0.11 0.23 0.32 0.28 0.34 0.37 0.31 0.31
Guide to interpret your prediction scores:
Following ROC data was obtained during training of 159 proteins for predicting single nucleotide and nucleotide steps using neural network. (SDCPred returns real values and binding information is obtained at various cutoffs as in the following tables)

Overall single nucleotide-wise average ROC
AUC of ROC (Ade) 76.9%
AUC of ROC (Cyt) 76.5%
AUC of ROC (Gua) 77.4%
AUC of ROC (Thy) 76.0%
Detailed ROC Data:

Cutoff Sensitivity (Ade) Specificity (Ade) Sensitivity (Cyt) Specificity (Cyt) Sensitivity (Gua) Specificity (Gua) Sensitivity (Thy) Specificity (Thy)
0 1 0 1 0 1 0 1 0
0.1 0.97 0.26 0.98 0.17 0.93 0.35 0.98 0.09
0.2 0.90 0.45 0.93 0.37 0.85 0.54 0.94 0.27
0.3 0.82 0.57 0.85 0.53 0.78 0.64 0.88 0.45
0.4 0.75 0.64 0.77 0.65 0.70 0.71 0.80 0.59
0.5 0.69 0.71 0.64 0.73 0.62 0.77 0.69 0.70
0.6 0.61 0.77 0.52 0.81 0.54 0.83 0.59 0.78
0.7 0.52 0.83 0.38 0.88 0.45 0.88 0.46 0.86
0.8 0.40 0.89 0.23 0.94 0.32 0.92 0.23 0.93
0.9 0.20 0.95 0.05 0.98 0.16 0.97 0.03 0.99

AUC of ROC for binding to Dinucleotide steps
AUC of ROC (AA/TT) 77.6%
AUC of ROC (AC/GT) 77.3%
AUC of ROC (AG/CT) 74.7%
AUC of ROC (AT/AT) 75.3%
AUC of ROC (CA/TG) 78.6%
AUC of ROC (CC/GG) 75.9%
AUC of ROC (CG/CG) 73.4%
AUC of ROC (GA/TC) 75.6%
AUC of ROC (GC/GC) 74.3%
AUC of ROC (TA/TA) 78.8%
Detailed ROC Data
Cutoff Sensi (AA/TT) Speci (AA/TT) Sensi (AC/GT) Speci (AC/GT) Sensi (AG/CT) Speci (AG/CT) Sensi (AT/AT) Speci (AT/AT) Sensi (CA/TG) Speci (CA/TG) Sensi (CC/GG) Speci (CC/GG) Sensi (CG/CG) Speci (CG/CG) Sensi (GA/TC) Speci (GA/TC) Sensi (GC/GC) Speci (GC/GC) Sensi (TA/TA) Speci (TA/TA)
0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0
0.1 0.98 0.10 0.98 0.14 0.96 0.21 0.96 0.26 0.98 0.21 0.97 0.17 0.95 0.19 0.96 0.22 0.98 0.22 1 0.00
0.2 0.95 0.26 0.94 0.37 0.90 0.37 0.90 0.44 0.93 0.37 0.94 0.34 0.92 0.35 0.92 0.37 0.93 0.37 0.98 0.12
0.3 0.90 0.40 0.85 0.53 0.86 0.49 0.83 0.56 0.89 0.48 0.89 0.47 0.87 0.46 0.86 0.48 0.89 0.47 0.94 0.30
0.4 0.86 0.52 0.76 0.65 0.80 0.58 0.73 0.65 0.83 0.59 0.82 0.58 0.81 0.56 0.81 0.57 0.81 0.56 0.90 0.47
0.5 0.80 0.62 0.65 0.75 0.72 0.66 0.65 0.73 0.76 0.68 0.72 0.67 0.71 0.65 0.73 0.65 0.75 0.64 0.84 0.62
0.6 0.70 0.72 0.48 0.85 0.63 0.73 0.51 0.80 0.65 0.77 0.60 0.76 0.61 0.73 0.65 0.73 0.64 0.72 0.71 0.75
0.7 0.56 0.81 0.27 0.93 0.53 0.80 0.36 0.87 0.49 0.85 0.46 0.84 0.44 0.81 0.54 0.81 0.47 0.79 0.41 0.87
0.8 0.38 0.90 0.10 0.97 0.38 0.88 0.22 0.92 0.31 0.93 0.24 0.92 0.30 0.89 0.38 0.89 0.32 0.87 0.17 0.96
0.9 0.14 0.97 0.01 0.99 0.17 0.94 0.08 0.97 0.04 0.99 0.03 0.99 0.11 0.97 0.14 0.96 0.15 0.95 0.01 0.99


Alignments used in generating PSSM are written below.

BLASTP 2.2.16 [Mar-25-2007]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= Fasta generated from webin
         (128 letters)

Database: nr 
           8,483,808 sequences; 2,914,572,939 total letters

Searching..................................................done


Results from round 1


                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ref|NP_786976.1| galectin-1 [Bos taurus] >gi|126174|sp|P11116|LE...   246   3e-64
pdb|1SLA|A Chain A, X-Ray Crystallography Reveals Crosslinking O...   246   5e-64
sp|P81184|LEG1_SHEEP RecName: Full=Galectin-1; AltName: Full=Lec...   239   5e-62
ref|NP_001009287.1| galectin 1 [Ovis aries] >gi|47779226|gb|AAT3...   233   5e-60
sp|Q49I35|LEG1_PIG RecName: Full=Galectin-1; AltName: Full=Lecti...   226   4e-58
ref|NP_001135409.1| galectin-1 [Papio anubis] >gi|161598215|gb|A...   225   9e-58
gb|AAT37622.1| galectin-1 [Sus scrofa]                                224   1e-57
gb|ABX74930.1| beta-galactoside-binding lectin precursor [Ateles...   224   2e-57
gb|ABE01403.1| galectin 1 [Sus scrofa]                                223   3e-57
gb|ABX74931.1| beta-galactoside-binding lectin precursor [Vareci...   223   4e-57
ref|NP_001001867.1| galectin 1 [Sus scrofa] >gi|90421309|gb|ABD9...   222   7e-57
ref|XP_001501082.1| PREDICTED: similar to Galectin-1 (Lectin gal...   222   8e-57
ref|XP_001083427.1| PREDICTED: lectin, galactoside-binding, solu...   222   9e-57
gb|AAP36586.1| Homo sapiens lectin, galactoside-binding, soluble...   221   1e-56
ref|NP_063969.1| lectin, galactoside-binding, soluble, 1 [Rattus...   221   2e-56
ref|NP_002296.1| galectin-1 [Homo sapiens] >gi|114686335|ref|XP_...   221   2e-56
pdb|1GZW|B Chain B, X-Ray Crystal Structure Of Human Galectin-1 ...   220   3e-56
sp|P48538|LEG1_CRIGR RecName: Full=Galectin-1; AltName: Full=Lec...   220   3e-56
ref|NP_001126310.1| lectin, galactoside-binding, soluble, 1 [Pon...   220   3e-56
gb|AAH02063.1| Lectin, galactose binding, soluble 1 [Mus musculus]    219   4e-56
pdb|1W6Q|B Chain B, X-Ray Crystal Structure Of R111h Human Galec...   218   9e-56
ref|NP_032521.1| lectin, galactose binding, soluble 1 [Mus muscu...   218   1e-55
pdb|1GZW|A Chain A, X-Ray Crystal Structure Of Human Galectin-1       217   3e-55
pdb|1W6M|B Chain B, X-Ray Crystal Structure Of C2s Human Galecti...   216   4e-55
gb|AAA37667.1| beta-galactoside binding protein                       215   9e-55
pdb|1W6Q|A Chain A, X-Ray Crystal Structure Of R111h Human Galec...   215   1e-54
ref|XP_001161991.1| PREDICTED: hypothetical protein isoform 1 [P...   213   4e-54
pdb|1W6M|A Chain A, X-Ray Crystal Structure Of C2s Human Galecti...   213   5e-54
ref|XP_001083299.1| PREDICTED: lectin, galactoside-binding, solu...   209   5e-53
ref|XP_852831.1| PREDICTED: similar to Galectin-1 (Beta-galactos...   207   3e-52
ref|XP_549042.2| PREDICTED: similar to Galectin-1 (Beta-galactos...   205   8e-52
pdb|2ZKN|A Chain A, X-Ray Structure Of Mutant Galectin-1LACTOSE ...   205   1e-51
dbj|BAC56336.1| similar to galactose-binding lectin [Bos taurus]      202   7e-51
ref|XP_001510347.1| PREDICTED: similar to Galectin-1 (Lectin gal...   200   4e-50
dbj|BAC56513.1| similar to galactose-binding lectin [Bos taurus]      185   1e-45
dbj|BAC56327.1| similar to galactose-binding lectin [Bos taurus]      184   3e-45
dbj|BAC56326.1| similar to galactose-binding lectin [Bos taurus]      174   2e-42
emb|CAA36183.1| unnamed protein product [Mus musculus]                169   8e-41
ref|XP_001376589.1| PREDICTED: similar to Chain B, X-Ray Crystal...   162   1e-38
ref|XP_002195307.1| PREDICTED: galectin CG-16 [Taeniopygia guttata]   152   7e-36
gb|ACH44734.1| putative galectin CG-16 [Taeniopygia guttata]          147   4e-34
dbj|BAC56536.1| similar to galactose-binding lectin [Bos taurus]      144   2e-33
ref|NP_996788.1| galectin CG-16 [Gallus gallus] >gi|126165|sp|P2...   144   3e-33
ref|NP_990826.1| galectin-1 [Gallus gallus] >gi|126163|sp|P07583...   143   4e-33
pdb|1QMJ|A Chain A, Cg-16, A Homodimeric Agglutinin From Chicken...   143   4e-33
prf||1304250A lectin,beta galactoside binding                         143   5e-33
pir||B28302 beta-galactoside-binding lectin, placental - human  ...   139   6e-32
gb|ACH44733.1| putative galectin CG-16 [Taeniopygia guttata]          131   2e-29
ref|NP_001079039.1| galectin-Ia [Xenopus laevis] >gi|18147670|db...   125   1e-27
gb|AAA48626.1| 16 kDa beta-galactoside-binding lectin                 124   2e-27
ref|NP_001079744.1| hypothetical protein LOC379433 [Xenopus laev...   122   1e-26
sp|P56217|LEG1_BUFAR RecName: Full=Galectin-1 >gi|3892010|pdb|1A...   116   6e-25
pdb|1GAN|A Chain A, Complex Of Toad Ovary Galectin With N-Acetyl...   116   7e-25
gb|AAH27504.1| Lgals2 protein [Mus musculus]                          108   2e-22
sp|Q9CQW5|LEG2_MOUSE RecName: Full=Galectin-2 >gi|12840865|dbj|B...   107   4e-22
gb|AAA36172.1| beta-galactoside-binding lectin                        105   1e-21
ref|NP_079898.1| lectin, galactose-binding, soluble 2 [Mus muscu...   105   1e-21
gb|AAA37313.1| 14 kDa beta-galactoside-binding lectin (L-14.5)        105   2e-21
dbj|BAB25661.1| unnamed protein product [Mus musculus]                103   4e-21
ref|NP_001136314.1| lectin, galactoside-binding, soluble, 3 [Sus...   103   4e-21
ref|NP_001135709.1| hypothetical protein LOC100216286 [Xenopus (...   102   9e-21
ref|NP_001116913.1| lectin, galactoside-binding, soluble, 2 [Xen...   102   2e-20
ref|NP_001123680.1| hypothetical protein LOC100170434 [Xenopus (...   101   2e-20
gb|ACM08322.1| Beta-galactoside-binding lectin [Salmo salar] >gi...   101   2e-20
ref|NP_956808.1| lectin, galactoside-binding, soluble, 1 (galect...   100   4e-20
gb|ACM08580.1| Beta-galactoside-binding lectin [Salmo salar]          100   6e-20
ref|XP_001087063.1| PREDICTED: similar to lectin, galactoside-bi...   100   7e-20
ref|NP_001134631.1| Beta-galactoside-binding lectin [Salmo salar...    99   9e-20
gb|ACO07656.1| Beta-galactoside-binding lectin [Oncorhynchus myk...    99   1e-19
gb|ACO07452.1| Beta-galactoside-binding lectin [Oncorhynchus myk...    99   1e-19
ref|XP_001499566.1| PREDICTED: similar to lectin, galactoside-bi...    99   1e-19
emb|CAF87201.1| unnamed protein product [Tetraodon nigroviridis]       99   2e-19
ref|NP_006489.1| lectin, galactoside-binding, soluble, 2 [Homo s...    99   2e-19
gb|AAX37150.1| lectin galactoside-binding soluble 2 [synthetic c...    99   2e-19
gb|ABW04130.1| galactoside binding lectin [Epinephelus coioides]       98   2e-19
pdb|1HLC|A Chain A, X-Ray Crystal Structure Of The Human Dimeric...    98   2e-19
gb|AAH29063.2| LGALS2 protein [Homo sapiens]                           98   2e-19
gb|AAA36171.1| beta-galactoside-binding lectin                         97   3e-19
gb|ABJ80692.1| beta-galactoside-binding lectin [Hippoglossus hip...    97   3e-19
ref|NP_598283.1| lectin, galactoside-binding, soluble 2 [Rattus ...    97   4e-19
ref|NP_001079042.1| galectin family xgalectin-Vb [Xenopus laevis...    97   4e-19
gb|ACO08703.1| Beta-galactoside-binding lectin [Oncorhynchus myk...    97   5e-19
gb|AAI69857.1| Galectin family xgalectin-Vb [Xenopus laevis] >gi...    97   5e-19
gb|ACO08799.1| Beta-galactoside-binding lectin [Oncorhynchus myk...    97   6e-19
ref|XP_525588.2| PREDICTED: lectin, galactoside-binding, soluble...    96   7e-19
ref|NP_001079245.1| lactose-binding lectin [Xenopus laevis] >gi|...    96   8e-19
sp|Q29373|LEG2_PIG RecName: Full=Galectin-2                            95   2e-18
ref|XP_531742.1| PREDICTED: similar to lectin, galactoside-bindi...    94   3e-18
ref|XP_002196044.1| PREDICTED: similar to lectin galactoside-bin...    94   5e-18
ref|XP_001510438.1| PREDICTED: similar to beta-galactoside-bindi...    93   6e-18
ref|XP_861690.1| PREDICTED: similar to lectin, galactoside-bindi...    92   1e-17
gb|AAH71424.1| Lgals1l2 protein [Danio rerio]                          91   2e-17
gb|EDM15848.1| lectin, galactoside-binding, soluble 2, isoform C...    91   3e-17
emb|CAG04110.1| unnamed protein product [Tetraodon nigroviridis]       91   3e-17
ref|NP_001068962.1| lectin, galactoside-binding, soluble, 2 [Bos...    91   3e-17
ref|NP_998059.1| proto galectin Gal1-L2 [Danio rerio] >gi|402881...    91   3e-17
ref|XP_001376599.1| PREDICTED: similar to Galectin-1 (Lectin gal...    91   4e-17
gb|ACO51808.1| Galectin-1 [Rana catesbeiana]                           90   5e-17
sp|P08520|LEG_ELEEL RecName: Full=Beta-galactoside-binding lecti...    89   2e-16
gb|AAF61069.1|AF220550_1 galectin [Paralichthys olivaceus]             87   4e-16
gb|ACI69049.1| Galectin-2 [Salmo salar]                                82   1e-14
ref|XP_001376472.1| PREDICTED: similar to S-lac lectin [Monodelp...    82   1e-14
gb|ACI68076.1| Galectin-2 [Salmo salar] >gi|223646284|gb|ACN0990...    81   3e-14
gb|ACN10131.1| Galectin-2 [Salmo salar] >gi|223672601|gb|ACN1248...    80   4e-14
ref|NP_001005958.1| lectin, galactoside-binding, soluble, 1 (gal...    79   9e-14
gb|AAB60464.1| beta-galactoside-binding lectin                         78   2e-13
ref|XP_001330970.1| PREDICTED: hypothetical protein [Danio rerio]      77   4e-13
gb|ACM08436.1| Beta-galactoside-binding lectin [Salmo salar]           72   2e-11
ref|XP_001083444.1| PREDICTED: lectin, galactoside-binding, solu...    68   3e-10
gb|AAH42911.2| LGALS7B protein [Homo sapiens]                          67   5e-10
ref|NP_002298.1| galectin-7 [Homo sapiens] >gi|109948279|ref|NP_...    67   6e-10
pdb|3GAL|A Chain A, Crystal Structure Of Human Galectin-7 In Com...    67   6e-10
dbj|BAA36385.1| Conger eel galectin (Congerin I) [Conger myriaster]    66   1e-09
pdb|1C1F|A Chain A, Ligand-Free Congerin I >gi|6435675|pdb|1C1L|...    65   1e-09
ref|XP_001367884.1| PREDICTED: similar to galectin-7 [Monodelphi...    65   2e-09
sp|Q801X7|AJL1_ANGJA RecName: Full=Galactose-binding lectin l-1;...    64   4e-09
sp|P26788|LEG1_CONMY RecName: Full=Congerin-1; AltName: Full=Con...    64   5e-09
gb|ACC54752.1| galactose-binding lectin soluble 1 [Xenopus borea...    60   7e-08
gb|AAB40658.1| galectin-7 [Rattus norvegicus]                          59   1e-07
ref|XP_001234400.1| PREDICTED: similar to galectin-2 related pro...    59   2e-07
sp|P47953|LEG3_CRILO RecName: Full=Galectin-3; AltName: Full=Gal...    59   2e-07
ref|XP_422899.2| PREDICTED: similar to galectin-2 related protei...    58   2e-07
pdb|1WLC|A Chain A, Congerin Ii Y16sT88I DOUBLE MUTANT                 58   3e-07
ref|XP_001255073.1| PREDICTED: similar to lectin, galactose bind...    58   3e-07
ref|XP_001495783.2| PREDICTED: similar to lectin, galactose bind...    58   3e-07
pdb|1WLD|A Chain A, Congerin Ii T88i Single Mutant                     58   3e-07
ref|XP_001915598.1| PREDICTED: similar to galectin 9, partial [E...    58   3e-07
ref|XP_001915607.1| PREDICTED: similar to urate transporter/chan...    57   4e-07
sp|P82447|LEG1_PODHI RecName: Full=Galectin-1                          57   5e-07
pdb|1WLW|A Chain A, Congerin Ii Y16s Single Mutant                     57   6e-07
gb|AAB19412.2| beta-galactoside binding protein [Homo sapiens]         57   6e-07
sp|Q9YIC2|LEG2_CONMY RecName: Full=Congerin-2; AltName: Full=Con...    57   6e-07
gb|AAA41378.1| IgE binding protein                                     57   6e-07
gb|EDL20743.1| lectin, galactose binding, soluble 3, isoform CRA...    57   6e-07
gb|EEC12826.1| galectin, putative [Ixodes scapularis]                  57   7e-07
pdb|1IS3|A Chain A, Lactose And Mes-Liganded Congerin Ii >gi|241...    57   7e-07
gb|EDL88351.1| lectin, galactose binding, soluble 3, isoform CRA...    56   8e-07
ref|NP_001009251.1| galectin-14 [Ovis aries] >gi|17226660|gb|AAL...    56   8e-07
gb|EDL88352.1| lectin, galactose binding, soluble 3, isoform CRA...    56   8e-07
dbj|BAE43211.1| unnamed protein product [Mus musculus]                 55   1e-06
ref|NP_001015570.1| galectin-9 isoform 2 [Bos taurus] >gi|598583...    55   2e-06
ref|NP_072104.2| lectin, galactose binding, soluble 7 [Rattus no...    55   2e-06
gb|AAB88871.1| galectin-7 [Rattus norvegicus]                          55   2e-06
ref|NP_001034266.1| galectin-9 isoform 1 [Bos taurus]                  55   2e-06
sp|Q3MHZ8|LEG9_BOVIN RecName: Full=Galectin-9 >gi|75775171|gb|AA...    55   3e-06
ref|NP_001136315.1| lectin, galactoside-binding, soluble, 7 [Sus...    55   3e-06
gb|EDL20744.1| lectin, galactose binding, soluble 3, isoform CRA...    54   3e-06
emb|CAA34206.1| unnamed protein product [Mus sp.]                      54   3e-06
sp|P16110|LEG3_MOUSE RecName: Full=Galectin-3; AltName: Full=Gal...    54   3e-06
ref|NP_034835.1| galectin 3 [Mus musculus] >gi|225543163|ref|NP_...    54   3e-06
sp|O54974|LEG7_MOUSE RecName: Full=Galectin-7; Short=Gal-7 >gi|2...    54   3e-06
ref|NP_032522.2| lectin, galactose binding, soluble 7 [Mus muscu...    54   3e-06
dbj|BAB26108.1| unnamed protein product [Mus musculus]                 54   3e-06
sp|P08699|LEG3_RAT RecName: Full=Galectin-3; AltName: Full=Galac...    54   4e-06
ref|NP_114020.1| galectin 3 [Rattus norvegicus] >gi|203174|gb|AA...    54   4e-06
ref|NP_001003345.1| galectin-9 [Canis lupus familiaris] >gi|4610...    54   4e-06
ref|XP_001519384.1| PREDICTED: similar to galectin-7 [Ornithorhy...    54   4e-06
ref|NP_001082204.1| galectin family xgalectin-IIa [Xenopus laevi...    54   4e-06
ref|XP_001504125.1| PREDICTED: similar to galectin 9 short isofo...    54   6e-06
gb|AAK29385.1|AF331640_1 beta-galactoside-binding protein galect...    54   6e-06
ref|NP_001029940.1| galectin-4 [Bos taurus] >gi|122145086|sp|Q3T...    53   6e-06
gb|AAA16211.1| beta-galactosides-binding lectin                        53   7e-06
ref|XP_853675.1| PREDICTED: similar to Galectin-3 (Galactose-spe...    53   7e-06
ref|XP_001504129.2| PREDICTED: similar to galectin 9 short isofo...    53   8e-06
ref|XP_001496714.1| PREDICTED: similar to galectin-7 [Equus caba...    53   8e-06
gb|ACI67584.1| Galectin-9 [Salmo salar]                                53   8e-06
sp|P38486|LEG3_CANFA RecName: Full=Galectin-3; AltName: Full=Gal...    53   8e-06
ref|NP_001022189.1| gaLECtin family member (lec-2) [Caenorhabdit...    53   9e-06
ref|XP_001507412.1| PREDICTED: similar to promyelocytic leukemia...    53   9e-06
ref|XP_001497400.2| PREDICTED: similar to Galectin-4 (Lactose-bi...    53   1e-05
dbj|BAD93151.1| Galectin-8 variant [Homo sapiens]                      53   1e-05
gb|AAD45404.1| Po66 carbohydrate binding protein 2 [Homo sapiens]      52   1e-05
ref|XP_001157677.1| PREDICTED: similar to Galectin-8 variant iso...    52   1e-05
gb|EAW70055.1| lectin, galactoside-binding, soluble, 8 (galectin...    52   1e-05
gb|EAW70053.1| lectin, galactoside-binding, soluble, 8 (galectin...    52   1e-05
ref|NP_006490.3| galectin-8 isoform a [Homo sapiens] >gi|4254419...    52   1e-05
ref|NP_963837.1| galectin-8 isoform b [Homo sapiens] >gi|4254419...    52   1e-05
emb|CAA62904.1| Galectin-8 [Homo sapiens]                              52   1e-05
ref|XP_001157611.1| PREDICTED: galectin 8 isoform 1 [Pan troglod...    52   1e-05
sp|O00214|LEG8_HUMAN RecName: Full=Galectin-8; Short=Gal-8; AltN...    52   1e-05
gb|AAD45403.1| Po66 carbohydrate binding protein 1 [Homo sapiens...    52   1e-05
gb|AAF19370.1| galectin-8 [Homo sapiens] >gi|208966326|dbj|BAG73...    52   1e-05
ref|NP_001011449.1| lectin, galactoside-binding, soluble, 4 (gal...    52   1e-05
gb|AAD45402.1| Po66 carbohydrate binding protein [Homo sapiens]        52   1e-05
ref|NP_001134305.1| Galectin-3 [Salmo salar] >gi|209732232|gb|AC...    52   2e-05
ref|NP_496165.3| gaLECtin family member (lec-2) [Caenorhabditis ...    52   2e-05
gb|EDL15598.1| lectin, galactose binding, soluble 9, isoform CRA...    52   2e-05
gb|AAB51605.1| prostate carcinoma tumor antigen [Homo sapiens]         52   2e-05
ref|XP_001158037.1| PREDICTED: similar to lymphocyte/NHL galecti...    52   2e-05
ref|XP_001158092.1| PREDICTED: galectin 8 isoform 9 [Pan troglod...    52   2e-05
ref|NP_001075807.1| lectin, galactoside-binding, soluble, 3 [Ory...    52   2e-05
gb|EDM06985.1| lectin, galactoside-binding, soluble 8, isoform C...    52   2e-05
ref|XP_001492208.1| PREDICTED: similar to Lectin, galactoside-bi...    52   2e-05
dbj|BAG58824.1| unnamed protein product [Homo sapiens]                 52   2e-05
emb|CAI24051.1| lectin, galactose binding, soluble 9 [Mus muscul...    52   2e-05
gb|AAH03754.1| Lgals9 protein [Mus musculus]                           52   2e-05
sp|O08573|LEG9_MOUSE RecName: Full=Galectin-9 >gi|1916604|gb|AAB...    52   2e-05
ref|NP_001152773.1| lectin, galactose binding, soluble 9 isoform...    52   2e-05
emb|CAG32015.1| hypothetical protein [Gallus gallus]                   52   2e-05
gb|ABD97855.1| galectin 8 variant I [Gallus gallus]                    52   2e-05
ref|NP_034838.2| lectin, galactose binding, soluble 9 isoform 1 ...    52   2e-05
emb|CAF93222.1| unnamed protein product [Tetraodon nigroviridis]       52   2e-05
ref|NP_001010843.1| lectin, galactoside-binding, soluble, 8 (gal...    52   2e-05
ref|NP_446314.2| galectin 8 [Rattus norvegicus] >gi|47938975|gb|...    52   2e-05
pdb|2YRO|A Chain A, Solution Structure Of The C-Terminal Gal-Bin...    52   2e-05
ref|NP_001076182.1| galectin-4 [Oryctolagus cuniculus] >gi|58821...    52   2e-05
dbj|BAG59217.1| unnamed protein product [Homo sapiens]                 51   3e-05
gb|AAA37311.1| carbohydrate binding protein 35                         51   3e-05
dbj|BAE33025.1| unnamed protein product [Mus musculus]                 51   3e-05
gb|EDL32311.1| lectin, galactose binding, soluble 8, isoform CRA...    51   3e-05
dbj|BAC35918.1| unnamed protein product [Mus musculus]                 51   3e-05
gb|ABS45108.1| galectin-8L [Mus musculus]                              51   3e-05
ref|NP_006140.1| galectin-4 [Homo sapiens] >gi|3024079|sp|P56470...    51   3e-05
gb|AAP36224.1| Homo sapiens lectin, galactoside-binding, soluble...    51   3e-05
ref|NP_061374.1| lectin, galactose binding, soluble 8 [Mus muscu...    51   3e-05
ref|XP_001496731.1| PREDICTED: similar to galectin-7 [Equus caba...    51   4e-05
dbj|BAE01861.1| unnamed protein product [Macaca fascicularis]          51   4e-05
ref|XP_001098674.1| PREDICTED: similar to galectin 8 isoform b i...    51   4e-05
ref|XP_001098571.1| PREDICTED: similar to galectin 8 isoform a i...    51   4e-05
ref|XP_001098377.1| PREDICTED: similar to galectin 8 isoform b i...    51   4e-05
pdb|2D6O|X Chain X, Crystal Structure Of Mouse Galectin-9 N-Term...    51   4e-05
pdb|2D6K|A Chain A, Crystal Structure Of Mouse Galectin-9 N-Term...    51   4e-05
ref|XP_855387.1| PREDICTED: similar to Galectin-4 (Lactose-bindi...    51   4e-05
ref|XP_001517844.1| PREDICTED: similar to urate transporter/chan...    51   4e-05
ref|XP_002192605.1| PREDICTED: lectin, galactoside-binding, solu...    50   4e-05
ref|XP_001099398.1| PREDICTED: similar to galectin 8 isoform a i...    50   5e-05
ref|NP_999097.1| urate transporter/channel protein, isoform (UAT...    50   5e-05
emb|CAB44278.1| urate transporter/channel protein (UATp) [Sus sc...    50   5e-05
gb|ACJ60642.1| lectin galactoside-binding soluble 9 protein [Sus...    50   5e-05
gb|AAD39095.1|AF105337_1 galectin GAL-1 [Teladorsagia circumcinc...    50   5e-05
gb|ACO08221.1| Galectin-9 [Oncorhynchus mykiss]                        50   5e-05
gb|AAC47547.1| galectin [Teladorsagia circumcincta] >gi|3341813|...    50   5e-05
ref|XP_001375560.1| PREDICTED: similar to galectin-9 [Monodelphi...    50   6e-05
gb|AAK16736.1|AF342816_1 colorectal carcinoma-derived galectin-8...    50   6e-05
ref|NP_001117663.1| galectin like protein [Oncorhynchus mykiss] ...    50   6e-05
dbj|BAG58923.1| unnamed protein product [Homo sapiens]                 50   7e-05
gb|AAL77076.1|AF468213_1 lymphocyte/NHL galectin-8 long isoform ...    50   7e-05
ref|NP_001039419.1| galectin-8 [Bos taurus] >gi|82571499|gb|AAI1...    50   7e-05
gb|ABC47040.1| galectin 8 [Sparus aurata]                              50   7e-05
ref|XP_001098074.1| PREDICTED: similar to galectin 8 isoform b i...    50   8e-05
gb|AAD11972.1| galectin [Haemonchus contortus]                         50   9e-05
pdb|2NMN|A Chain A, Crystal Structure Of Human Galectin-3 Carboh...    50   9e-05
pdb|1A3K|A Chain A, X-Ray Crystal Structure Of The Human Galecti...    50   9e-05
gb|AAK69827.1| lymphocyte/NHL galectin-8 short isoform [Homo sap...    50   9e-05
gb|ACI66798.1| Galectin-9 [Salmo salar]                                50   9e-05
gb|AAA37314.1| 34 kDa beta-galactoside-binding lectin (L-34)           49   1e-04
sp|Q62665|LEG8_RAT RecName: Full=Galectin-8; AltName: Full=30 kD...    49   1e-04
ref|XP_001471707.1| PREDICTED: hypothetical protein [Mus musculus]     49   1e-04
ref|XP_001918023.1| PREDICTED: similar to lectin, galactoside-bi...    49   1e-04
dbj|BAE00669.1| unnamed protein product [Macaca fascicularis]          49   1e-04
pdb|1KJL|A Chain A, High Resolution X-Ray Structure Of Human Gal...    49   1e-04
gb|AAF63404.1|AF105967_1 galectin [Haemonchus contortus]               49   1e-04
ref|NP_001118080.1| VHSV-induced protein-9 [Oncorhynchus mykiss]...    49   1e-04
ref|NP_034836.1| lectin, galactose binding, soluble 4 [Mus muscu...    49   1e-04
gb|AAH94008.1| Lectin, galactose binding, soluble 4 [Mus musculus]     49   1e-04
ref|XP_001148424.1| PREDICTED: similar to galactose-specific lec...    49   1e-04
ref|XP_001370559.1| PREDICTED: similar to hCG22119, [Monodelphis...    49   1e-04
gb|AAF37721.1|AF237486_1 galectin [Brugia malayi]                      49   1e-04
gb|ABQ09359.1| tandem-repeat galectin [Biomphalaria glabrata]          49   1e-04
ref|NP_001082202.1| galectin family xgalectin-IIIa [Xenopus laev...    49   1e-04
gb|AAH77487.1| Xgalectin-IIIa protein [Xenopus laevis]                 49   1e-04
ref|NP_999858.2| chimera galectin Gal3 [Danio rerio] >gi|7916011...    49   2e-04
ref|NP_001079041.1| galectin 4 [Xenopus laevis] >gi|27884291|dbj...    49   2e-04
gb|AAR84191.1| chimera galectin Gal3 [Danio rerio]                     49   2e-04
emb|CAD61918.1| unnamed protein product [Homo sapiens]                 49   2e-04
ref|NP_001135558.1| lectin, galactoside-binding, soluble, 8 (gal...    49   2e-04
gb|AAH93113.1| Lgals3l protein [Danio rerio]                           49   2e-04
ref|XP_001788803.1| PREDICTED: similar to galectin-14 [Bos taurus]     49   2e-04
ref|XP_392379.2| PREDICTED: similar to Galectin-4 (Lactose-bindi...    48   2e-04
gb|ABS28869.1| tandem repeat galectin [Biomphalaria glabrata]          48   2e-04
ref|NP_001133778.1| Galectin-8 [Salmo salar] >gi|209155304|gb|AC...    48   2e-04
ref|NP_034837.1| lectin, galactose binding, soluble 6 [Mus muscu...    48   2e-04
gb|AAC27244.1| galectin-6 [Mus musculus]                               48   2e-04
ref|XP_002126450.1| PREDICTED: similar to galectin 8 [Ciona inte...    48   2e-04
dbj|BAC55887.1| galectin family xgalectin-VIIIa [Xenopus laevis]       48   2e-04
ref|NP_001082394.1| galectin family xgalectin-VIIIa [Xenopus lae...    48   2e-04
gb|EAW80659.1| hCG22119, isoform CRA_b [Homo sapiens]                  48   3e-04
ref|NP_001136299.1| lectin, galactoside-binding, soluble, 8 [Sus...    48   3e-04
ref|XP_001084043.1| PREDICTED: galectin 4 [Macaca mulatta]             48   3e-04
gb|EAW80661.1| hCG22119, isoform CRA_c [Homo sapiens]                  48   3e-04
ref|NP_001090970.1| lectin, galactoside-binding, soluble, 3 [Sus...    48   3e-04
gb|AAA35607.1| IgE-binding protein >gi|186922|gb|AAA36163.1| lam...    48   3e-04
gb|AAA88086.1| galactose-specific lectin [Homo sapiens]                48   3e-04
ref|NP_002297.2| galectin 3 [Homo sapiens] >gi|215274262|sp|P179...    48   3e-04
dbj|BAD92628.1| LGALS3 protein variant [Homo sapiens]                  48   3e-04
ref|NP_001095811.1| galectin 3 [Bos taurus] >gi|151553789|gb|AAI...    48   3e-04
ref|XP_001148447.1| PREDICTED: galectin 9 isoform 1 [Pan troglod...    48   3e-04
ref|XP_001678521.1| Hypothetical protein CBG13371 [Caenorhabditi...    48   3e-04
ref|XP_001375542.1| PREDICTED: similar to lectin, galactoside-bi...    48   3e-04
ref|XP_001148579.1| PREDICTED: galectin 9 isoform 3 [Pan troglod...    47   4e-04
ref|XP_001900812.1| galectin [Brugia malayi] >gi|158591679|gb|ED...    47   4e-04
emb|CAG46894.1| LGALS3 [Homo sapiens]                                  47   4e-04
gb|AAX37050.1| lectin galactoside-binding soluble 3 [synthetic c...    47   4e-04
ref|NP_497763.1| gaLECtin family member (lec-4) [Caenorhabditis ...    47   4e-04
ref|XP_001148520.1| PREDICTED: galectin 9 isoform 2 [Pan troglod...    47   4e-04
dbj|BAB83623.1| galectin-9 [Homo sapiens] >gi|119571423|gb|EAW51...    47   5e-04
dbj|BAA31542.1| ecalectin [Homo sapiens] >gi|193785124|dbj|BAG54...    47   5e-04
ref|NP_002299.2| galectin-9 isoform short [Homo sapiens] >gi|181...    47   5e-04
gb|AAH68068.1| Lectin, galactoside-binding, soluble, 3 [Homo sap...    47   5e-04
gb|EAW51042.1| lectin, galactoside-binding, soluble, 9 (galectin...    47   5e-04
emb|CAI11727.1| novel protein similar to vertebrate lectin, gala...    47   5e-04
emb|CAG01500.1| unnamed protein product [Tetraodon nigroviridis]       47   5e-04
gb|AAH88813.1| Lgals9-prov protein [Xenopus tropicalis]                47   5e-04
gb|EDM05383.1| rCG33388, isoform CRA_a [Rattus norvegicus]             47   5e-04
ref|XP_001895582.1| Galactoside-binding lectin family protein [B...    47   5e-04
sp|P97840|LEG9_RAT RecName: Full=Galectin-9; AltName: Full=36 kD...    47   5e-04
gb|AAB51192.1| 36 kDa beta-galactoside binding lectin                  47   5e-04
gb|AAI53700.1| Lgals9 protein [Xenopus tropicalis]                     47   5e-04
ref|NP_037109.1| lectin, galactoside-binding, soluble, 9 [Rattus...    47   5e-04
emb|CAB93851.1| galectin-9 [Homo sapiens]                              47   6e-04
pdb|2DYC|A Chain A, Crystal Structure Of The N-Terminal Domain O...    47   6e-04
dbj|BAD96952.1| galectin 9 short isoform variant [Homo sapiens]        47   6e-04
gb|EAW51040.1| lectin, galactoside-binding, soluble, 9 (galectin...    47   6e-04
dbj|BAG58799.1| unnamed protein product [Homo sapiens]                 47   6e-04
ref|NP_033665.1| galectin-9 isoform long [Homo sapiens] >gi|3041...    47   6e-04
ref|NP_037108.1| lectin, galactose binding, soluble 5 [Rattus no...    47   6e-04
gb|AAM44060.1|AF510729_1 galectin-4 [Mus musculus]                     47   6e-04
ref|NP_001096318.1| hypothetical protein LOC100124899 [Xenopus (...    47   6e-04
ref|XP_001156415.1| PREDICTED: hypothetical protein isoform 1 [P...    47   7e-04
ref|XP_001156813.1| PREDICTED: hypothetical protein isoform 3 [P...    47   7e-04
dbj|BAG59256.1| unnamed protein product [Homo sapiens]                 47   7e-04
gb|AAA20541.1| beta-galactoside-binding lectin                         47   7e-04
gb|ACI33460.1| Galectin-9 [Salmo salar] >gi|223648464|gb|ACN1099...    47   7e-04
sp|Q6DKI2|LEG9C_HUMAN RecName: Full=Galectin-9C; AltName: Full=G...    47   7e-04
ref|NP_001035167.2| galectin 9 like [Homo sapiens]                     47   7e-04
dbj|BAF98709.1| unnamed protein product [Homo sapiens]                 47   7e-04
ref|NP_001036150.1| galectin-9 like [Homo sapiens]                     47   7e-04
sp|Q3B8N2|LEG9B_HUMAN RecName: Full=Galectin-9B; AltName: Full=G...    47   7e-04
gb|AAF37720.1|AF237485_1 galectin [Dirofilaria immitis]                47   8e-04
ref|NP_999146.1| galectin-4 [Sus scrofa] >gi|2833353|sp|Q29058|L...    46   8e-04
gb|AAI05944.1| Lectin, galactoside-binding, soluble, 9B [Homo sa...    46   8e-04
ref|XP_001156867.1| PREDICTED: hypothetical protein isoform 4 [P...    46   8e-04
dbj|BAF82952.1| unnamed protein product [Homo sapiens]                 46   8e-04
ref|XP_001156930.1| PREDICTED: hypothetical protein isoform 5 [P...    46   8e-04
gb|AAC27245.1| galectin-4 [Mus musculus]                               46   9e-04
ref|NP_001140054.1| Galectin-4 [Salmo salar] >gi|221221532|gb|AC...    46   9e-04
ref|XP_001156690.1| PREDICTED: hypothetical protein isoform 2 [P...    46   0.001
gb|ABN54798.1| galectin 4-like protein transcript variant [Halio...    46   0.001
pdb|2EAK|A Chain A, Crystal Structure Of Human Galectin-9 N-Term...    46   0.001
ref|XP_536335.2| PREDICTED: similar to galectin 8 isoform a [Can...    46   0.001
ref|NP_001120550.1| hypothetical protein LOC100145704 [Xenopus (...    46   0.001
ref|XP_001678524.1| Hypothetical protein CBG13368 [Caenorhabditi...    46   0.001
emb|CAI11728.1| novel protein similar to vertebrate lectin, gala...    46   0.001
gb|ACO36044.1| galectin [Pinctada fucata]                              45   0.001
ref|NP_037107.1| lectin, galactoside-binding, soluble, 4 [Rattus...    45   0.002
dbj|BAB11970.1| galectin LEC-4 [Caenorhabditis elegans]                45   0.002
ref|XP_001896448.1| galectin [Brugia malayi] >gi|158596375|gb|ED...    45   0.002
ref|XP_781871.1| PREDICTED: hypothetical protein [Strongylocentr...    45   0.002
ref|XP_001362707.1| PREDICTED: similar to galectin-4 isoform 2 [...    45   0.002
gb|AAI06496.1| LOC733366 protein [Xenopus laevis]                      45   0.002
gb|AAI08826.1| Xgalectin-iva protein [Xenopus laevis]                  45   0.002
ref|NP_001022405.1| gaLECtin family member (lec-1) [Caenorhabdit...    45   0.002
gb|AAH84416.1| Xgalectin-iva protein [Xenopus laevis]                  45   0.002
ref|XP_001085890.1| PREDICTED: similar to Galectin-3 (Galactose-...    45   0.002
ref|XP_001362619.1| PREDICTED: similar to galectin-4 isoform 1 [...    45   0.002
ref|NP_496801.2| gaLECtin family member (lec-1) [Caenorhabditis ...    45   0.002
dbj|BAB83259.1| galectin family xgalectin-IVa [Xenopus laevis]         45   0.002
gb|AAH97632.1| Xgalectin-iva protein [Xenopus laevis]                  45   0.002
ref|XP_002190965.1| PREDICTED: similar to galectin related inter...    45   0.002
emb|CAF89524.1| unnamed protein product [Tetraodon nigroviridis]       45   0.002
gb|ABG75998.1| galectin [Crassostrea virginica]                        45   0.003
ref|NP_001022531.1| gaLECtin family member (lec-3) [Caenorhabdit...    45   0.003
gb|AAH54324.1| Xgalectin-VIa protein [Xenopus laevis]                  45   0.003
pdb|2YY1|A Chain A, Crystal Sturcture Of N-Terminal Domain Of Hu...    45   0.003
ref|XP_001679448.1| Hypothetical protein CBG02815 [Caenorhabditi...    44   0.003
ref|NP_956366.1| lectin, galactoside-binding, soluble, 9 (galect...    44   0.003
ref|NP_001082398.1| galectin family xgalectin-IIIb [Xenopus laev...    44   0.003
gb|EDM05381.1| rCG35210 [Rattus norvegicus]                            44   0.004
gb|AAH99354.1| Xgalectin-IIIb protein [Xenopus laevis]                 44   0.004
emb|CAA88922.1| galectin [Homo sapiens]                                44   0.004
gb|AAF63406.1|AF105969_1 galectin [Haemonchus contortus] >gi|300...    44   0.004
ref|NP_001082396.1| galectin family xgalectin-VIa [Xenopus laevi...    44   0.004
ref|XP_002069239.1| GK21075 [Drosophila willistoni] >gi|19416532...    44   0.004
gb|AAP05998.1| galectin [Haemonchus contortus]                         44   0.004
gb|AAF63405.1|AF105968_1 galectin [Haemonchus contortus]               44   0.004
gb|AAH56859.1| Xgalectin-iva protein [Xenopus laevis]                  44   0.005
ref|XP_522043.1| PREDICTED: lectin, galactoside-binding, soluble...    44   0.005
ref|XP_001161075.1| PREDICTED: lectin, galactoside-binding, solu...    44   0.005
ref|NP_001003430.1| galectin related inter-fiber protein [Danio ...    44   0.005
gb|ACI67845.1| Galectin-9 [Salmo salar]                                44   0.006
sp|O44126|LEG1_HAECO RecName: Full=32 kDa beta-galactoside-bindi...    44   0.006
emb|CAX12786.1| novel protein [Danio rerio]                            44   0.006
ref|XP_001961593.1| GF15050 [Drosophila ananassae] >gi|190615290...    43   0.007
ref|NP_001096100.1| hypothetical protein LOC100124603 [Danio rer...    43   0.007
ref|NP_001022532.1| gaLECtin family member (lec-3) [Caenorhabdit...    43   0.008
emb|CAD79473.1| galectin-4 (lectin, galactoside-binding, soluble...    43   0.009
dbj|BAF75419.1| galectin [Crassostrea gigas]                           43   0.010
ref|NP_476535.1| galectin-related inter-fiber protein [Rattus no...    43   0.010
gb|EDL89729.1| galectin-related inter-fiber protein, isoform CRA...    43   0.010
gb|EDL89728.1| galectin-related inter-fiber protein, isoform CRA...    43   0.010
ref|NP_001022533.1| gaLECtin family member (lec-3) [Caenorhabdit...    42   0.012
gb|AAA65445.1| galectin-5                                              42   0.013
ref|NP_496159.1| gaLECtin family member (lec-3) [Caenorhabditis ...    42   0.013
gb|AAR84192.1| tandem-repeat galectin Gal9-L1 [Danio rerio]            42   0.014
gb|AAB02856.1| galectin-3                                              42   0.015
gb|EAW51041.1| lectin, galactoside-binding, soluble, 9 (galectin...    42   0.017
dbj|BAG63109.1| unnamed protein product [Homo sapiens]                 42   0.017
ref|NP_001136316.1| lectin, galactoside-binding, soluble, 12 [Su...    42   0.018
ref|NP_999756.1| galectin 3 [Gallus gallus] >gi|19568746|gb|AAL9...    42   0.018
ref|XP_002200440.1| PREDICTED: galectin 3 [Taeniopygia guttata]        42   0.018
ref|XP_001115802.1| PREDICTED: similar to lectin, galactoside-bi...    42   0.019
ref|XP_001999300.1| GI23146 [Drosophila mojavensis] >gi|19391589...    42   0.019
gb|ABC69709.1| galactoside-binding lectin [Crassostrea ariakensis]     42   0.020
gb|EAW87249.1| hCG18434 [Homo sapiens]                                 42   0.021
ref|XP_002248728.1| hypothetical protein BRAFLDRAFT_289597 [Bran...    42   0.022
ref|XP_002230376.1| hypothetical protein BRAFLDRAFT_126856 [Bran...    42   0.022
ref|NP_084298.1| galectin-related inter-fiber protein [Mus muscu...    42   0.022
ref|XP_001665578.1| hypothetical protein CBG09221 [Caenorhabditi...    41   0.028
ref|XP_001809056.1| PREDICTED: similar to galectin 4-like protei...    41   0.032
gb|ABO25859.1| galectin-3 [Gallus gallus]                              41   0.033
ref|XP_001160945.1| PREDICTED: similar to galectin-12 isoform c ...    41   0.038
ref|XP_001160989.1| PREDICTED: similar to galectin-12 splice for...    41   0.038
ref|XP_704272.2| PREDICTED: similar to Galectin-3 (Galactose-spe...    41   0.042
emb|CAE17639.1| novel protein similar to vertebrate galectins [D...    40   0.046
ref|XP_002001555.1| GI16246 [Drosophila mojavensis] >gi|19391213...    40   0.049
ref|NP_001001817.1| galactoside-binding soluble lectin 9 [Danio ...    40   0.051
emb|CAE17638.1| novel protein similar to vertebrate galectins [D...    40   0.051
gb|AAH76011.1| Zgc:92326 protein [Danio rerio]                         40   0.051
gb|EAL23956.1| similar to galectin-related inter-fiber protein [...    40   0.052
ref|XP_001921992.1| PREDICTED: similar to galectin 9 short [Dani...    40   0.054
sp|A4D1Z8|GRIFN_HUMAN RecName: Full=Putative grifin; AltName: Fu...    40   0.054
gb|AAH95566.1| Zgc:92326 [Danio rerio]                                 40   0.057
emb|CAJ43112.1| galectin 2 [Suberites domuncula]                       40   0.061
gb|EEB10608.1| conserved hypothetical protein [Pediculus humanus...    40   0.067
gb|ABX54711.1| GRIFIN [Cavia porcellus]                                40   0.079
emb|CAG13238.1| unnamed protein product [Tetraodon nigroviridis]       40   0.081
ref|XP_001115789.1| PREDICTED: similar to lectin, galactoside-bi...    40   0.084
ref|XP_001115794.1| PREDICTED: similar to lectin, galactoside-bi...    40   0.084
ref|XP_001901075.1| Galactoside-binding lectin family protein [B...    40   0.085
ref|XP_002059112.1| GJ16210 [Drosophila virilis] >gi|194155986|g...    40   0.091
ref|NP_149092.2| lectin, galactoside-binding, soluble, 12 isofor...    40   0.092
ref|NP_001136008.1| lectin, galactoside-binding, soluble, 12 iso...    40   0.092
gb|AAG40863.1|AF310686_1 galectin-12 splice form 1 [Homo sapiens]      40   0.092
ref|XP_001518275.1| PREDICTED: similar to galectin-12 splice for...    39   0.11 
ref|XP_001989432.1| GH11722 [Drosophila grimshawi] >gi|193905432...    39   0.12 
emb|CAI13767.1| lectin, galactoside-binding, soluble, 8 [Homo sa...    39   0.13 
emb|CAI13768.1| lectin, galactoside-binding, soluble, 8 [Homo sa...    39   0.13 
emb|CAI13769.1| lectin, galactoside-binding, soluble, 8 [Homo sa...    39   0.14 
emb|CAI13766.1| lectin, galactoside-binding, soluble, 8 [Homo sa...    39   0.15 
ref|XP_688206.3| PREDICTED: similar to galectin 8 [Danio rerio]        39   0.15 
gb|ACA09732.1| tandem repeat galectin [Venerupis philippinarum]        39   0.15 
gb|EEB16079.1| Galectin-4, putative [Pediculus humanus corporis]       39   0.16 
ref|XP_001602230.1| PREDICTED: similar to galectin 4-like protei...    39   0.16 
gb|EAW70057.1| lectin, galactoside-binding, soluble, 8 (galectin...    39   0.17 
ref|XP_001519379.1| PREDICTED: similar to galectin-4, partial [O...    39   0.18 
emb|CAI13772.1| lectin, galactoside-binding, soluble, 8 [Homo sa...    39   0.19 
gb|ABM74074.1| galectin-6 [Mus musculus castaneus]                     39   0.21 
ref|XP_540894.2| PREDICTED: similar to lectin, galactoside-bindi...    38   0.21 
emb|CAN87718.1| novel protein containing a galactoside-binding l...    38   0.26 
ref|NP_001023759.2| hypothetical protein DC2.3 [Caenorhabditis e...    38   0.27 
ref|XP_001334396.2| PREDICTED: similar to chimera galectin Gal3 ...    38   0.29 
gb|AAG40864.1|AF310687_1 galectin-12 splice form 2 [Homo sapiens]      37   0.37 
gb|EAW74153.1| lectin, galactoside-binding, soluble, 12 (galecti...    37   0.37 
ref|NP_001136007.1| lectin, galactoside-binding, soluble, 12 iso...    37   0.37 
ref|NP_001136009.1| lectin, galactoside-binding, soluble, 12 iso...    37   0.41 
ref|NP_001136010.1| lectin, galactoside-binding, soluble, 12 iso...    37   0.41 
ref|NP_001023758.2| hypothetical protein DC2.3 [Caenorhabditis e...    37   0.42 
gb|AAF34676.1|AF222694_1 galectin-related inhibitor of prolifera...    37   0.42 
ref|XP_597134.2| PREDICTED: similar to lectin, galactoside-bindi...    37   0.44 
gb|ABV60341.1| putative galectin [Lutzomyia longipalpis]               37   0.46 
ref|XP_001368937.1| PREDICTED: similar to galectin-4 [Monodelphi...    37   0.47 
gb|ACN63468.1| MIP06854p [Drosophila melanogaster]                     37   0.48 
ref|XP_001667383.1| Hypothetical protein CBG01879 [Caenorhabditi...    37   0.52 
ref|XP_001509441.1| PREDICTED: similar to olfactory receptor Olr...    37   0.55 
ref|XP_002077579.1| GD22998 [Drosophila simulans] >gi|194189588|...    37   0.55 
ref|NP_608487.1| galectin [Drosophila melanogaster] >gi|19421844...    37   0.57 
ref|XP_547010.2| PREDICTED: similar to galectin-related inter-fi...    37   0.58 
ref|XP_001901599.1| Galactoside-binding lectin family protein [B...    37   0.59 
gb|AAB40001.1| putative fiber protein [porcine adenovirus 4] >gi...    37   0.62 
ref|XP_002041522.1| GM16712 [Drosophila sechellia] >gi|194123295...    37   0.63 
gb|ACN88633.1| MIP07382p [Drosophila melanogaster]                     37   0.63 
ref|XP_002020956.1| GL16594 [Drosophila persimilis] >gi|19411790...    37   0.70 
ref|XP_001357096.2| GA10954 [Drosophila pseudoobscura pseudoobsc...    37   0.72 
emb|CAE17637.1| novel protein similar to vertebrate galectins [D...    37   0.76 
ref|NP_001099803.1| lectin, galactoside-binding, soluble, 12 [Ra...    37   0.78 
ref|XP_606783.3| PREDICTED: similar to galectin-related inter-fi...    37   0.78 
emb|CAP26737.1| Hypothetical protein CBG06431 [Caenorhabditis br...    36   0.92 
emb|CAG10725.1| unnamed protein product [Tetraodon nigroviridis]       36   1.0  
gb|ACE74678.1| galectin [Caenorhabditis brenneri]                      36   1.0  
ref|XP_002319103.1| predicted protein [Populus trichocarpa] >gi|...    36   1.2  
ref|XP_971732.1| PREDICTED: similar to galectin (AGAP008844-PA) ...    36   1.2  
ref|ZP_03829675.1| hypothetical protein PcarbP_23840 [Pectobacte...    35   1.4  
ref|XP_002325330.1| predicted protein [Populus trichocarpa] >gi|...    35   1.4  
gb|EEF40372.1| serine/threonine protein phosphatase, putative [R...    35   1.5  
emb|CAI13771.1| lectin, galactoside-binding, soluble, 8 [Homo sa...    35   1.5  
ref|XP_001865727.1| 32 kDa beta-galactoside-binding lectin lec-3...    35   1.5  
ref|XP_002059113.1| GJ16209 [Drosophila virilis] >gi|194155987|g...    35   1.6  
emb|CAD37940.1| galectin [Suberites domuncula]                         35   1.6  
ref|YP_303332.1| NAD-dependent DNA ligase [Ehrlichia canis str. ...    35   1.6  
ref|XP_001366624.1| PREDICTED: similar to GRIFIN [Monodelphis do...    35   1.6  
ref|XP_002325331.1| predicted protein [Populus trichocarpa] >gi|...    35   1.7  
emb|CAM15341.1| novel protein similar to lectin, galactoside-bin...    35   1.7  
gb|EEB14046.1| galectin, putative [Pediculus humanus corporis]         35   1.8  
ref|XP_002087369.1| GE16549 [Drosophila yakuba] >gi|194173470|gb...    35   1.9  
dbj|BAF43802.1| galectin [Ornithodoros moubata] >gi|134131403|db...    35   2.0  
ref|XP_001968113.1| GG24692 [Drosophila erecta] >gi|190659980|gb...    35   2.1  
ref|NP_062389.1| lectin, galactose binding, soluble 12 [Mus musc...    35   2.2  
dbj|BAC28345.1| unnamed protein product [Mus musculus]                 35   2.2  
gb|AAH30890.1| Lgals12 protein [Mus musculus]                          35   2.2  
gb|AAK77326.1|AF244978_1 galectin-12 [Mus musculus] >gi|15010848...    35   2.2  

>ref|NP_786976.1| galectin-1 [Bos taurus]
 sp|P11116|LEG1_BOVIN RecName: Full=Galectin-1; AltName: Full=Lectin galactoside-binding
           soluble 1; AltName: Full=Beta-galactoside-binding lectin
           L-14-I; Short=Lactose-binding lectin 1; AltName:
           Full=S-Lac lectin 1; AltName: Full=Galaptin; AltName:
           Full=14 kDa lectin
 emb|CAA32508.1| unnamed protein product [Bos taurus]
 dbj|BAC56529.1| similar to galactose-binding lectin [Bos taurus]
 gb|AAI03157.1| Lectin, galactoside-binding, soluble, 1 [Bos taurus]
          Length = 135

 Score =  246 bits (629), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 128/134 (95%), Positives = 128/134 (95%), Gaps = 6/134 (4%)

Query: 1   ACGLVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNLC---NPRFNAHGDVNTIVC 57
           ACGLVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNLC   NPRFNAHGDVNTIVC
Sbjct: 2   ACGLVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNLCLHFNPRFNAHGDVNTIVC 61

Query: 58  NSKDAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYL 114
           NSKDAGAWGAEQRESAFPFQPGSVVEV   FNQTDLTIKLPDGYEFKFPNRLNLEAINYL
Sbjct: 62  NSKDAGAWGAEQRESAFPFQPGSVVEVCISFNQTDLTIKLPDGYEFKFPNRLNLEAINYL 121

Query: 115 SAGGDFKIKCVAFE 128
           SAGGDFKIKCVAFE
Sbjct: 122 SAGGDFKIKCVAFE 135


>pdb|1SLA|A Chain A, X-Ray Crystallography Reveals Crosslinking Of Mammalian
           Lectin (Galectin-1) By Biantennary Complex Type
           Saccharides
 pdb|1SLA|B Chain B, X-Ray Crystallography Reveals Crosslinking Of Mammalian
           Lectin (Galectin-1) By Biantennary Complex Type
           Saccharides
 pdb|1SLB|A Chain A, X-Ray Crystallography Reveals Crosslinking Of Mammalian
           Lectin (Galectin-1) By Biantennary Complex Type
           Saccharides
 pdb|1SLB|B Chain B, X-Ray Crystallography Reveals Crosslinking Of Mammalian
           Lectin (Galectin-1) By Biantennary Complex Type
           Saccharides
 pdb|1SLB|C Chain C, X-Ray Crystallography Reveals Crosslinking Of Mammalian
           Lectin (Galectin-1) By Biantennary Complex Type
           Saccharides
 pdb|1SLB|D Chain D, X-Ray Crystallography Reveals Crosslinking Of Mammalian
           Lectin (Galectin-1) By Biantennary Complex Type
           Saccharides
 pdb|1SLC|A Chain A, X-Ray Crystallography Reveals Crosslinking Of Mammalian
           Lectin (Galectin-1) By Biantennary Complex Type
           Saccharides
 pdb|1SLC|B Chain B, X-Ray Crystallography Reveals Crosslinking Of Mammalian
           Lectin (Galectin-1) By Biantennary Complex Type
           Saccharides
 pdb|1SLC|C Chain C, X-Ray Crystallography Reveals Crosslinking Of Mammalian
           Lectin (Galectin-1) By Biantennary Complex Type
           Saccharides
 pdb|1SLC|D Chain D, X-Ray Crystallography Reveals Crosslinking Of Mammalian
           Lectin (Galectin-1) By Biantennary Complex Type
           Saccharides
 pdb|1SLT|A Chain A, Structure Of S-Lectin, A Developmentally Regulated
           Vertebrate Beta-Galactoside Binding Protein
 pdb|1SLT|B Chain B, Structure Of S-Lectin, A Developmentally Regulated
           Vertebrate Beta-Galactoside Binding Protein
 gb|AAB22210.1| beta-galactoside-binding lectin [cattle, heart, Peptide, 134 aa]
          Length = 134

 Score =  246 bits (628), Expect = 5e-64,   Method: Composition-based stats.
 Identities = 128/134 (95%), Positives = 128/134 (95%), Gaps = 6/134 (4%)

Query: 1   ACGLVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNLC---NPRFNAHGDVNTIVC 57
           ACGLVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNLC   NPRFNAHGDVNTIVC
Sbjct: 1   ACGLVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNLCLHFNPRFNAHGDVNTIVC 60

Query: 58  NSKDAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYL 114
           NSKDAGAWGAEQRESAFPFQPGSVVEV   FNQTDLTIKLPDGYEFKFPNRLNLEAINYL
Sbjct: 61  NSKDAGAWGAEQRESAFPFQPGSVVEVCISFNQTDLTIKLPDGYEFKFPNRLNLEAINYL 120

Query: 115 SAGGDFKIKCVAFE 128
           SAGGDFKIKCVAFE
Sbjct: 121 SAGGDFKIKCVAFE 134


>sp|P81184|LEG1_SHEEP RecName: Full=Galectin-1; AltName: Full=Lectin galactoside-binding
           soluble 1; AltName: Full=Beta-galactoside-binding lectin
           L-14-I; Short=Lactose-binding lectin 1; AltName:
           Full=S-Lac lectin 1; AltName: Full=Galaptin; AltName:
           Full=14 kDa lectin; AltName: Full=OPG-1
          Length = 135

 Score =  239 bits (610), Expect = 5e-62,   Method: Composition-based stats.
 Identities = 123/134 (91%), Positives = 125/134 (93%), Gaps = 6/134 (4%)

Query: 1   ACGLVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNLC---NPRFNAHGDVNTIVC 57
           ACGLVASNLNLKPGECLRVRGEVAADAKSF LNLGKDDNNLC   NPRFNAHGD+NTIVC
Sbjct: 2   ACGLVASNLNLKPGECLRVRGEVAADAKSFSLNLGKDDNNLCLHFNPRFNAHGDINTIVC 61

Query: 58  NSKDAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYL 114
           NSKD GAWGAEQRE+AFPFQPGSV EV   FNQTDLTIKLPDGYEFKFPNRLNLEAINYL
Sbjct: 62  NSKDGGAWGAEQRETAFPFQPGSVAEVCISFNQTDLTIKLPDGYEFKFPNRLNLEAINYL 121

Query: 115 SAGGDFKIKCVAFE 128
           SAGGDFKIKCVAFE
Sbjct: 122 SAGGDFKIKCVAFE 135


>ref|NP_001009287.1| galectin 1 [Ovis aries]
 gb|AAT38511.1| galectin-1 [Ovis aries]
          Length = 136

 Score =  233 bits (593), Expect = 5e-60,   Method: Composition-based stats.
 Identities = 122/135 (90%), Positives = 125/135 (92%), Gaps = 7/135 (5%)

Query: 1   AC-GLVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNLC---NPRFNAHGDVNTIV 56
           AC GLVASNLNLKPGECLRVRGEVAADAKSF LNLGKDDNNLC   NPRF AHGD+NTIV
Sbjct: 2   ACQGLVASNLNLKPGECLRVRGEVAADAKSFSLNLGKDDNNLCLHFNPRFEAHGDINTIV 61

Query: 57  CNSKDAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINY 113
           CNSKDAGAWGAEQRESAFPFQPGSV EV   FN+TDLTIKLPDGYEFKFPNRLNLEAINY
Sbjct: 62  CNSKDAGAWGAEQRESAFPFQPGSVAEVCVSFNETDLTIKLPDGYEFKFPNRLNLEAINY 121

Query: 114 LSAGGDFKIKCVAFE 128
           L+AGGDFKIKCVAFE
Sbjct: 122 LAAGGDFKIKCVAFE 136


>sp|Q49I35|LEG1_PIG RecName: Full=Galectin-1; AltName: Full=Lectin galactoside-binding
           soluble 1
 gb|AAX85355.1| lectin galactoside-binding soluble 1 [Sus scrofa]
          Length = 135

 Score =  226 bits (576), Expect = 4e-58,   Method: Composition-based stats.
 Identities = 114/134 (85%), Positives = 120/134 (89%), Gaps = 6/134 (4%)

Query: 1   ACGLVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNLC---NPRFNAHGDVNTIVC 57
           ACGLVASNLNLKPGECL+VRGEVA DAKSF+LNLGKD NNLC   NPRF+ HGD+NTIVC
Sbjct: 2   ACGLVASNLNLKPGECLKVRGEVAPDAKSFVLNLGKDSNNLCLHFNPRFDMHGDINTIVC 61

Query: 58  NSKDAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYL 114
           NSKD GAWGAEQRESAFPFQPGSVVEV   F QTDLTIKLPDGYEF FPNRLNLEAI +L
Sbjct: 62  NSKDGGAWGAEQRESAFPFQPGSVVEVCISFGQTDLTIKLPDGYEFSFPNRLNLEAIEHL 121

Query: 115 SAGGDFKIKCVAFE 128
           +A GDFKIKCVAFE
Sbjct: 122 AADGDFKIKCVAFE 135


>ref|NP_001135409.1| galectin-1 [Papio anubis]
 gb|ABX74928.1| beta-galactoside-binding lectin precursor [Papio anubis]
 gb|ABX74929.1| beta-galactoside-binding lectin precursor [Macaca mulatta]
 gb|ABX74932.1| beta-galactoside-binding lectin precursor [Cercopithecus cephus]
 gb|ABX74933.1| beta-galactoside-binding lectin precursor [Colobus guereza]
 gb|ACA58296.1| beta-galactoside-binding lectin precursor [Cercopithecus nictitans]
          Length = 135

 Score =  225 bits (574), Expect = 9e-58,   Method: Composition-based stats.
 Identities = 114/134 (85%), Positives = 120/134 (89%), Gaps = 6/134 (4%)

Query: 1   ACGLVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNLC---NPRFNAHGDVNTIVC 57
           ACGLVASNLNLKPGECLRVRGEVA DAKSF+LNLGKD NNLC   NPRFNAHGD NTIVC
Sbjct: 2   ACGLVASNLNLKPGECLRVRGEVAPDAKSFVLNLGKDSNNLCLHFNPRFNAHGDANTIVC 61

Query: 58  NSKDAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYL 114
           NSKD GAWG EQRE+AFPFQPGSV EV   F+Q DLTIKLPDGYEFKFPNRLNLEAINY+
Sbjct: 62  NSKDGGAWGTEQREAAFPFQPGSVAEVCITFDQADLTIKLPDGYEFKFPNRLNLEAINYM 121

Query: 115 SAGGDFKIKCVAFE 128
           +A GDFKIKCVAF+
Sbjct: 122 AADGDFKIKCVAFD 135


>gb|AAT37622.1| galectin-1 [Sus scrofa]
          Length = 134

 Score =  224 bits (572), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 113/133 (84%), Positives = 118/133 (88%), Gaps = 6/133 (4%)

Query: 1   ACGLVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNLC---NPRFNAHGDVNTIVC 57
           ACGLVASNLNLKPGECL+VRGEVA DAKSF+LNLGKD NNLC   NPRF+ HGD+NTIVC
Sbjct: 2   ACGLVASNLNLKPGECLKVRGEVAPDAKSFVLNLGKDSNNLCLHFNPRFDMHGDINTIVC 61

Query: 58  NSKDAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYL 114
           NSKD GAWGAEQRESAFPFQPGSVVEV   F  TDLTIKLPDGYEF FPNRLNLEAI YL
Sbjct: 62  NSKDGGAWGAEQRESAFPFQPGSVVEVCISFGHTDLTIKLPDGYEFSFPNRLNLEAIEYL 121

Query: 115 SAGGDFKIKCVAF 127
           +A GDFKIKCVAF
Sbjct: 122 AADGDFKIKCVAF 134


>gb|ABX74930.1| beta-galactoside-binding lectin precursor [Ateles fusciceps]
          Length = 135

 Score =  224 bits (570), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 115/134 (85%), Positives = 120/134 (89%), Gaps = 6/134 (4%)

Query: 1   ACGLVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNLC---NPRFNAHGDVNTIVC 57
           ACGL ASNLNLKPGECLRVRGEVA DAKSF+LNLGKD NNLC   NPRFNAHGD NTIVC
Sbjct: 2   ACGLEASNLNLKPGECLRVRGEVAPDAKSFVLNLGKDSNNLCLHFNPRFNAHGDANTIVC 61

Query: 58  NSKDAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYL 114
           NSKD GAWGAEQRE+AFPFQPGSV EV   FNQ DLTIKLPDGYEFKFPNRLNLEAINY+
Sbjct: 62  NSKDGGAWGAEQREAAFPFQPGSVAEVCISFNQADLTIKLPDGYEFKFPNRLNLEAINYM 121

Query: 115 SAGGDFKIKCVAFE 128
           +A GDFKIKCVAF+
Sbjct: 122 AADGDFKIKCVAFD 135


>gb|ABE01403.1| galectin 1 [Sus scrofa]
          Length = 135

 Score =  223 bits (569), Expect = 3e-57,   Method: Composition-based stats.
 Identities = 114/134 (85%), Positives = 119/134 (88%), Gaps = 6/134 (4%)

Query: 1   ACGLVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNLC---NPRFNAHGDVNTIVC 57
           ACGLVASNLNLKPGECL+VRGEVA DAKSF+LNLGKD NNLC   NPRF+ HGD+NTIVC
Sbjct: 2   ACGLVASNLNLKPGECLKVRGEVAPDAKSFVLNLGKDSNNLCLHFNPRFDMHGDINTIVC 61

Query: 58  NSKDAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYL 114
           NSKD GAWGAEQRESAFPFQPGSVVEV   F QTDLTIKLPDG EF FPNRLNLEAI YL
Sbjct: 62  NSKDGGAWGAEQRESAFPFQPGSVVEVCISFGQTDLTIKLPDGCEFSFPNRLNLEAIEYL 121

Query: 115 SAGGDFKIKCVAFE 128
           +A GDFKIKCVAFE
Sbjct: 122 AADGDFKIKCVAFE 135


>gb|ABX74931.1| beta-galactoside-binding lectin precursor [Varecia variegata]
          Length = 135

 Score =  223 bits (568), Expect = 4e-57,   Method: Composition-based stats.
 Identities = 113/134 (84%), Positives = 119/134 (88%), Gaps = 6/134 (4%)

Query: 1   ACGLVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNLC---NPRFNAHGDVNTIVC 57
           ACGLVASNLNLKPGECLRVRGEVA DAKSF+LNLGKD NNLC   NPRF+AHGD NTIVC
Sbjct: 2   ACGLVASNLNLKPGECLRVRGEVAPDAKSFVLNLGKDSNNLCLHFNPRFDAHGDANTIVC 61

Query: 58  NSKDAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYL 114
           NSKD GAWGAEQRESAFPFQPGSV EV   F+Q DLTI LPDGY FKFPNRLNLEAI+Y+
Sbjct: 62  NSKDGGAWGAEQRESAFPFQPGSVAEVCITFDQADLTITLPDGYAFKFPNRLNLEAISYM 121

Query: 115 SAGGDFKIKCVAFE 128
           +A GDFKIKCVAFE
Sbjct: 122 AADGDFKIKCVAFE 135


>ref|NP_001001867.1| galectin 1 [Sus scrofa]
 gb|ABD93885.1| galectin 1 [Sus scrofa]
          Length = 135

 Score =  222 bits (566), Expect = 7e-57,   Method: Composition-based stats.
 Identities = 113/134 (84%), Positives = 118/134 (88%), Gaps = 6/134 (4%)

Query: 1   ACGLVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNLC---NPRFNAHGDVNTIVC 57
           ACGLVASNLNLKPGECL+VRGEV  DAKSF+LNLGKD NNLC   NPRF+ HGD+NTIVC
Sbjct: 2   ACGLVASNLNLKPGECLKVRGEVTPDAKSFVLNLGKDSNNLCLHFNPRFDMHGDINTIVC 61

Query: 58  NSKDAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYL 114
           NSKD GAWGAEQRESAFPFQPGSVVEV   F QTDLTIKLPDG EF FPNRLNLEAI YL
Sbjct: 62  NSKDGGAWGAEQRESAFPFQPGSVVEVCISFGQTDLTIKLPDGCEFSFPNRLNLEAIEYL 121

Query: 115 SAGGDFKIKCVAFE 128
           +A GDFKIKCVAFE
Sbjct: 122 AADGDFKIKCVAFE 135


>ref|XP_001501082.1| PREDICTED: similar to Galectin-1 (Lectin galactoside-binding
           soluble 1) (Beta-galactoside-binding lectin L-14-I)
           (Lactose-binding lectin 1) (S-Lac lectin 1) (Galaptin)
           (14 kDa lectin) (HPL) (HBL) (Putative MAPK-activating
           protein PM12) [Equus caballus]
          Length = 135

 Score =  222 bits (565), Expect = 8e-57,   Method: Composition-based stats.
 Identities = 112/134 (83%), Positives = 118/134 (88%), Gaps = 6/134 (4%)

Query: 1   ACGLVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNLC---NPRFNAHGDVNTIVC 57
           ACGLVASNLNLKPGECLRVRGEVA DAKSF+LNLGKD +NLC   NPRFN HGD NTIVC
Sbjct: 2   ACGLVASNLNLKPGECLRVRGEVAPDAKSFVLNLGKDSDNLCLHFNPRFNMHGDANTIVC 61

Query: 58  NSKDAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYL 114
           NSKD GAWG EQRESAFPFQPGSV+EV   F++ DLTI LPDGY FKFPNRLNLEA+NYL
Sbjct: 62  NSKDGGAWGTEQRESAFPFQPGSVMEVCISFDKADLTITLPDGYSFKFPNRLNLEAVNYL 121

Query: 115 SAGGDFKIKCVAFE 128
           SA GDFKIKCVAFE
Sbjct: 122 SANGDFKIKCVAFE 135


>ref|XP_001083427.1| PREDICTED: lectin, galactoside-binding, soluble, 1 (galectin 1)
           isoform 2 [Macaca mulatta]
          Length = 135

 Score =  222 bits (565), Expect = 9e-57,   Method: Composition-based stats.
 Identities = 113/134 (84%), Positives = 119/134 (88%), Gaps = 6/134 (4%)

Query: 1   ACGLVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNLC---NPRFNAHGDVNTIVC 57
           ACGLVASNLNLKPGECLRVRGEVA DAKSF+LNLGKD NNLC   NPRFNA GD NTIVC
Sbjct: 2   ACGLVASNLNLKPGECLRVRGEVAPDAKSFVLNLGKDSNNLCLHFNPRFNAQGDANTIVC 61

Query: 58  NSKDAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYL 114
           NSKD GAWG EQRE+AFPFQPGSV EV   F+Q DLTIKLPDGYEFKFPNRLNLEAINY+
Sbjct: 62  NSKDGGAWGTEQREAAFPFQPGSVAEVCITFDQADLTIKLPDGYEFKFPNRLNLEAINYM 121

Query: 115 SAGGDFKIKCVAFE 128
           +A GDFKIKCVAF+
Sbjct: 122 AADGDFKIKCVAFD 135


>gb|AAP36586.1| Homo sapiens lectin, galactoside-binding, soluble, 1 (galectin 1)
           [synthetic construct]
 gb|AAX43293.1| lectin galactoside-binding soluble 1 [synthetic construct]
 gb|AAX43294.1| lectin galactoside-binding soluble 1 [synthetic construct]
          Length = 136

 Score =  221 bits (564), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 111/134 (82%), Positives = 119/134 (88%), Gaps = 6/134 (4%)

Query: 1   ACGLVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNLC---NPRFNAHGDVNTIVC 57
           ACGLVASNLNLKPGECLRVRGEVA DAKSF+LNLGKD NNLC   NPRFNAHGD NTIVC
Sbjct: 2   ACGLVASNLNLKPGECLRVRGEVAPDAKSFVLNLGKDSNNLCLHFNPRFNAHGDANTIVC 61

Query: 58  NSKDAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYL 114
           NSKD GAWG EQRE+ FPFQPGSV EV   F+Q +LT+KLPDGYEFKFPNRLNLEAINY+
Sbjct: 62  NSKDGGAWGTEQREAVFPFQPGSVAEVCITFDQANLTVKLPDGYEFKFPNRLNLEAINYM 121

Query: 115 SAGGDFKIKCVAFE 128
           +A GDFKIKCVAF+
Sbjct: 122 AADGDFKIKCVAFD 135


>ref|NP_063969.1| lectin, galactoside-binding, soluble, 1 [Rattus norvegicus]
 sp|P11762|LEG1_RAT RecName: Full=Galectin-1; AltName: Full=Lectin galactoside-binding
           soluble 1; AltName: Full=Beta-galactoside-binding lectin
           L-14-I; Short=Lactose-binding lectin 1; AltName:
           Full=S-Lac lectin 1; AltName: Full=Galaptin; AltName:
           Full=14 kDa lectin; AltName: Full=RL 14.5
 gb|AAA40822.1| beta-galactoside-binding protein
 gb|AAH58476.1| Lectin, galactoside-binding, soluble, 1 [Rattus norvegicus]
 gb|EDM15838.1| lectin, galactose binding, soluble 1 [Rattus norvegicus]
          Length = 135

 Score =  221 bits (563), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 109/134 (81%), Positives = 119/134 (88%), Gaps = 6/134 (4%)

Query: 1   ACGLVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNLC---NPRFNAHGDVNTIVC 57
           ACGLVASNLNLKPGECL+VRGE+A DAKSF+LNLGKD NNLC   NPRFNAHGD NTIVC
Sbjct: 2   ACGLVASNLNLKPGECLKVRGELAPDAKSFVLNLGKDSNNLCLHFNPRFNAHGDANTIVC 61

Query: 58  NSKDAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYL 114
           NSKD G WG EQRE+AFPFQPGS+ EV   F+Q DLTIKLPDG+EFKFPNRLN+EAINY+
Sbjct: 62  NSKDDGTWGTEQRETAFPFQPGSITEVCITFDQADLTIKLPDGHEFKFPNRLNMEAINYM 121

Query: 115 SAGGDFKIKCVAFE 128
           +A GDFKIKCVAFE
Sbjct: 122 AADGDFKIKCVAFE 135


>ref|NP_002296.1| galectin-1 [Homo sapiens]
 ref|XP_001162066.1| PREDICTED: hypothetical protein isoform 2 [Pan troglodytes]
 ref|XP_001162104.1| PREDICTED: hypothetical protein isoform 3 [Pan troglodytes]
 sp|P09382|LEG1_HUMAN RecName: Full=Galectin-1; AltName: Full=Lectin galactoside-binding
           soluble 1; AltName: Full=Beta-galactoside-binding lectin
           L-14-I; Short=Lactose-binding lectin 1; AltName:
           Full=S-Lac lectin 1; AltName: Full=Galaptin; AltName:
           Full=14 kDa lectin; AltName: Full=HPL; AltName:
           Full=HBL; AltName: Full=Putative MAPK-activating protein
           PM12
 emb|CAA32938.1| unnamed protein product [Homo sapiens]
 gb|AAB00777.1| 14 kDa beta-galactoside-binding lectin [Homo sapiens]
 gb|AAA36170.1| lectin precursor
 emb|CAA33328.1| 14 kDa beta-galactoside-binding lectin [Homo sapiens]
 emb|CAB42897.1| lectin, galactoside-binding, soluble, 1 (galectin 1) [Homo sapiens]
 gb|AAH01693.1| Lectin, galactoside-binding, soluble, 1 [Homo sapiens]
 gb|AAH20675.1| Lectin, galactoside-binding, soluble, 1 [Homo sapiens]
 gb|AAP35421.1| lectin, galactoside-binding, soluble, 1 (galectin 1) [Homo sapiens]
 dbj|BAC77389.1| putative MAPK activating protein [Homo sapiens]
 emb|CAG30397.1| LGALS1 [Homo sapiens]
 gb|AAX41649.1| lectin galactoside-binding soluble 1 [synthetic construct]
 gb|AAX41650.1| lectin galactoside-binding soluble 1 [synthetic construct]
 emb|CAK54541.1| LGALS1 [synthetic construct]
 emb|CAK54840.1| LGALS1 [synthetic construct]
 emb|CAL37536.1| hypothetical protein [synthetic construct]
 gb|EAW60178.1| lectin, galactoside-binding, soluble, 1 (galectin 1) [Homo sapiens]
 gb|ABM83189.1| lectin, galactoside-binding, soluble, 1 (galectin 1) [synthetic
           construct]
 gb|ABM86391.1| lectin, galactoside-binding, soluble, 1 (galectin 1) [synthetic
           construct]
 gb|ACA58297.1| beta-galactoside-binding lectin precursor [Homo sapiens]
 dbj|BAG35095.1| unnamed protein product [Homo sapiens]
 dbj|BAG72608.1| lectin, galactoside-binding, soluble, 1 [synthetic construct]
          Length = 135

 Score =  221 bits (562), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 111/134 (82%), Positives = 119/134 (88%), Gaps = 6/134 (4%)

Query: 1   ACGLVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNLC---NPRFNAHGDVNTIVC 57
           ACGLVASNLNLKPGECLRVRGEVA DAKSF+LNLGKD NNLC   NPRFNAHGD NTIVC
Sbjct: 2   ACGLVASNLNLKPGECLRVRGEVAPDAKSFVLNLGKDSNNLCLHFNPRFNAHGDANTIVC 61

Query: 58  NSKDAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYL 114
           NSKD GAWG EQRE+ FPFQPGSV EV   F+Q +LT+KLPDGYEFKFPNRLNLEAINY+
Sbjct: 62  NSKDGGAWGTEQREAVFPFQPGSVAEVCITFDQANLTVKLPDGYEFKFPNRLNLEAINYM 121

Query: 115 SAGGDFKIKCVAFE 128
           +A GDFKIKCVAF+
Sbjct: 122 AADGDFKIKCVAFD 135


>pdb|1GZW|B Chain B, X-Ray Crystal Structure Of Human Galectin-1
 prf||1713410A beta galactoside soluble lectin
 prf||1409286A beta galactoside binding lectin
          Length = 134

 Score =  220 bits (561), Expect = 3e-56,   Method: Composition-based stats.
 Identities = 111/134 (82%), Positives = 119/134 (88%), Gaps = 6/134 (4%)

Query: 1   ACGLVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNLC---NPRFNAHGDVNTIVC 57
           ACGLVASNLNLKPGECLRVRGEVA DAKSF+LNLGKD NNLC   NPRFNAHGD NTIVC
Sbjct: 1   ACGLVASNLNLKPGECLRVRGEVAPDAKSFVLNLGKDSNNLCLHFNPRFNAHGDANTIVC 60

Query: 58  NSKDAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYL 114
           NSKD GAWG EQRE+ FPFQPGSV EV   F+Q +LT+KLPDGYEFKFPNRLNLEAINY+
Sbjct: 61  NSKDGGAWGTEQREAVFPFQPGSVAEVCITFDQANLTVKLPDGYEFKFPNRLNLEAINYM 120

Query: 115 SAGGDFKIKCVAFE 128
           +A GDFKIKCVAF+
Sbjct: 121 AADGDFKIKCVAFD 134


>sp|P48538|LEG1_CRIGR RecName: Full=Galectin-1; AltName: Full=Lectin galactoside-binding
           soluble 1; AltName: Full=Beta-galactoside-binding lectin
           L-14-I; Short=Lactose-binding lectin 1; AltName:
           Full=S-Lac lectin 1; AltName: Full=Galaptin; AltName:
           Full=14 kDa lectin
 gb|AAA36995.1| 14 kDa beta-galactoside-binding lectin
          Length = 135

 Score =  220 bits (561), Expect = 3e-56,   Method: Composition-based stats.
 Identities = 111/134 (82%), Positives = 118/134 (88%), Gaps = 6/134 (4%)

Query: 1   ACGLVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNLC---NPRFNAHGDVNTIVC 57
           ACGLVASNLNLKPGECL+VRGEVA DAKSF+LNLGKD NNLC   NPRFNAHGD NTIVC
Sbjct: 2   ACGLVASNLNLKPGECLKVRGEVAPDAKSFVLNLGKDSNNLCLHFNPRFNAHGDANTIVC 61

Query: 58  NSKDAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYL 114
           NSKD GAWG E RE AFPFQPGS VEV   F+Q DLTIKLPDG+EFKFPNRLN+EAINY+
Sbjct: 62  NSKDNGAWGTEHREPAFPFQPGSTVEVCITFDQADLTIKLPDGHEFKFPNRLNMEAINYM 121

Query: 115 SAGGDFKIKCVAFE 128
           +A GDFKIKCVAFE
Sbjct: 122 AADGDFKIKCVAFE 135


>ref|NP_001126310.1| lectin, galactoside-binding, soluble, 1 [Pongo abelii]
 sp|Q5R7M1|LEG1_PONAB RecName: Full=Galectin-1; AltName: Full=Lectin galactoside-binding
           soluble 1; AltName: Full=Beta-galactoside-binding lectin
           L-14-I; Short=Lactose-binding lectin 1; AltName:
           Full=S-Lac lectin 1; AltName: Full=Galaptin; AltName:
           Full=14 kDa lectin
 emb|CAH92239.1| hypothetical protein [Pongo abelii]
          Length = 135

 Score =  220 bits (561), Expect = 3e-56,   Method: Composition-based stats.
 Identities = 111/134 (82%), Positives = 118/134 (88%), Gaps = 6/134 (4%)

Query: 1   ACGLVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNLC---NPRFNAHGDVNTIVC 57
           ACGLVASNLNLKPGECLRVRGEV  DAKSF+LNLGK  NNLC   NPRFNAHGD NTIVC
Sbjct: 2   ACGLVASNLNLKPGECLRVRGEVTPDAKSFVLNLGKASNNLCLHFNPRFNAHGDANTIVC 61

Query: 58  NSKDAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYL 114
           NSKD GAWG EQRE+ FPFQPGSV EV   F+QT+LTIKLPDGYEFKFPNRLNLEAINY+
Sbjct: 62  NSKDGGAWGTEQREAVFPFQPGSVAEVCITFDQTNLTIKLPDGYEFKFPNRLNLEAINYM 121

Query: 115 SAGGDFKIKCVAFE 128
           +A GDFKIKCVAF+
Sbjct: 122 AADGDFKIKCVAFD 135


>gb|AAH02063.1| Lectin, galactose binding, soluble 1 [Mus musculus]
          Length = 135

 Score =  219 bits (559), Expect = 4e-56,   Method: Composition-based stats.
 Identities = 107/134 (79%), Positives = 119/134 (88%), Gaps = 6/134 (4%)

Query: 1   ACGLVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNLC---NPRFNAHGDVNTIVC 57
           ACGLVASNLNLKPGECL+VRGEVA+DAKSF+LNLGKD NNLC   NPRFNAHGD NTIVC
Sbjct: 2   ACGLVASNLNLKPGECLKVRGEVASDAKSFVLNLGKDSNNLCLHFNPRFNAHGDANTIVC 61

Query: 58  NSKDAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYL 114
           N+K+ G WG E RE AFPFQPGS++EV   F+Q DLTIKLPDG+EFKFPNRLN+EAINY+
Sbjct: 62  NTKEDGTWGTEHREPAFPFQPGSIIEVCITFDQADLTIKLPDGHEFKFPNRLNMEAINYM 121

Query: 115 SAGGDFKIKCVAFE 128
           +A GDFKIKCVAFE
Sbjct: 122 AADGDFKIKCVAFE 135


>pdb|1W6Q|B Chain B, X-Ray Crystal Structure Of R111h Human Galectin-1
          Length = 134

 Score =  218 bits (556), Expect = 9e-56,   Method: Composition-based stats.
 Identities = 110/134 (82%), Positives = 118/134 (88%), Gaps = 6/134 (4%)

Query: 1   ACGLVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNLC---NPRFNAHGDVNTIVC 57
           ACGLVASNLNLKPGECLRVRGEVA DAKSF+LNLGKD NNLC   NPRFNAHGD NTIVC
Sbjct: 1   ACGLVASNLNLKPGECLRVRGEVAPDAKSFVLNLGKDSNNLCLHFNPRFNAHGDANTIVC 60

Query: 58  NSKDAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYL 114
           NSKD GAWG EQRE+ FPFQPGSV EV   F+Q +LT+KLPDGYEFKFPN LNLEAINY+
Sbjct: 61  NSKDGGAWGTEQREAVFPFQPGSVAEVCITFDQANLTVKLPDGYEFKFPNHLNLEAINYM 120

Query: 115 SAGGDFKIKCVAFE 128
           +A GDFKIKCVAF+
Sbjct: 121 AADGDFKIKCVAFD 134


>ref|NP_032521.1| lectin, galactose binding, soluble 1 [Mus musculus]
 sp|P16045|LEG1_MOUSE RecName: Full=Galectin-1; AltName: Full=Lectin galactoside-binding
           soluble 1; AltName: Full=Beta-galactoside-binding lectin
           L-14-I; Short=Lactose-binding lectin 1; AltName:
           Full=S-Lac lectin 1; AltName: Full=Galaptin; AltName:
           Full=14 kDa lectin
 emb|CAA37242.1| unnamed protein product [Mus musculus]
 emb|CAA34117.1| unnamed protein product [Mus musculus]
 emb|CAA47143.1| L14 lectin [Mus musculus]
 emb|CAA35930.1| betagalactoside binding protein [Mus musculus]
 gb|AAH99479.1| Lectin, galactose binding, soluble 1 [Mus musculus]
          Length = 135

 Score =  218 bits (556), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 107/134 (79%), Positives = 118/134 (88%), Gaps = 6/134 (4%)

Query: 1   ACGLVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNLC---NPRFNAHGDVNTIVC 57
           ACGLVASNLNLKPGECL+VRGEVA+DAKSF+LNLGKD NNLC   NPRFNAHGD NTIVC
Sbjct: 2   ACGLVASNLNLKPGECLKVRGEVASDAKSFVLNLGKDSNNLCLHFNPRFNAHGDANTIVC 61

Query: 58  NSKDAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYL 114
           N+K+ G WG E RE AFPFQPGS+ EV   F+Q DLTIKLPDG+EFKFPNRLN+EAINY+
Sbjct: 62  NTKEDGTWGTEHREPAFPFQPGSITEVCITFDQADLTIKLPDGHEFKFPNRLNMEAINYM 121

Query: 115 SAGGDFKIKCVAFE 128
           +A GDFKIKCVAFE
Sbjct: 122 AADGDFKIKCVAFE 135


>pdb|1GZW|A Chain A, X-Ray Crystal Structure Of Human Galectin-1
          Length = 134

 Score =  217 bits (552), Expect = 3e-55,   Method: Composition-based stats.
 Identities = 110/134 (82%), Positives = 118/134 (88%), Gaps = 6/134 (4%)

Query: 1   ACGLVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNLC---NPRFNAHGDVNTIVC 57
           ACGLVASNLNLKPGE LRVRGEVA DAKSF+LNLGKD NNLC   NPRFNAHGD NTIVC
Sbjct: 1   ACGLVASNLNLKPGEXLRVRGEVAPDAKSFVLNLGKDSNNLCLHFNPRFNAHGDANTIVC 60

Query: 58  NSKDAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYL 114
           NSKD GAWG EQRE+ FPFQPGSV EV   F+Q +LT+KLPDGYEFKFPNRLNLEAINY+
Sbjct: 61  NSKDGGAWGTEQREAVFPFQPGSVAEVCITFDQANLTVKLPDGYEFKFPNRLNLEAINYM 120

Query: 115 SAGGDFKIKCVAFE 128
           +A GDFKIKCVAF+
Sbjct: 121 AADGDFKIKCVAFD 134


>pdb|1W6M|B Chain B, X-Ray Crystal Structure Of C2s Human Galectin-1 Complexed
           With Galactose
 pdb|1W6N|B Chain B, X-Ray Crystal Structure Of C2s Human Galectin-1
 pdb|1W6O|B Chain B, X-Ray Crystal Structure Of C2s Human Galectin-1 Complexed
           With Lactose
 pdb|1W6P|B Chain B, X-Ray Crystal Structure Of C2s Human Galectin-1 Complexed
           With N-Acetyl-Lactosamine
          Length = 134

 Score =  216 bits (551), Expect = 4e-55,   Method: Composition-based stats.
 Identities = 110/134 (82%), Positives = 118/134 (88%), Gaps = 6/134 (4%)

Query: 1   ACGLVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNLC---NPRFNAHGDVNTIVC 57
           A GLVASNLNLKPGECLRVRGEVA DAKSF+LNLGKD NNLC   NPRFNAHGD NTIVC
Sbjct: 1   ASGLVASNLNLKPGECLRVRGEVAPDAKSFVLNLGKDSNNLCLHFNPRFNAHGDANTIVC 60

Query: 58  NSKDAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYL 114
           NSKD GAWG EQRE+ FPFQPGSV EV   F+Q +LT+KLPDGYEFKFPNRLNLEAINY+
Sbjct: 61  NSKDDGAWGTEQREAVFPFQPGSVAEVCITFDQANLTVKLPDGYEFKFPNRLNLEAINYM 120

Query: 115 SAGGDFKIKCVAFE 128
           +A GDFKIKCVAF+
Sbjct: 121 AADGDFKIKCVAFD 134


>gb|AAA37667.1| beta-galactoside binding protein
          Length = 135

 Score =  215 bits (548), Expect = 9e-55,   Method: Composition-based stats.
 Identities = 106/134 (79%), Positives = 117/134 (87%), Gaps = 6/134 (4%)

Query: 1   ACGLVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNLC---NPRFNAHGDVNTIVC 57
           ACGLVASNLNLKPGECL+VRGEVA+DAKSF+LNLGKD NNLC   NPRFNAHGD NTIVC
Sbjct: 2   ACGLVASNLNLKPGECLKVRGEVASDAKSFVLNLGKDSNNLCLHFNPRFNAHGDANTIVC 61

Query: 58  NSKDAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYL 114
           N+K+ G WG E RE A PFQPGS+ EV   F+Q DLTIKLPDG+EFKFPNRLN+EAINY+
Sbjct: 62  NTKEDGTWGTEHREPASPFQPGSITEVCITFDQADLTIKLPDGHEFKFPNRLNMEAINYM 121

Query: 115 SAGGDFKIKCVAFE 128
           +A GDFKIKCVAFE
Sbjct: 122 AADGDFKIKCVAFE 135


>pdb|1W6Q|A Chain A, X-Ray Crystal Structure Of R111h Human Galectin-1
          Length = 134

 Score =  215 bits (547), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 109/134 (81%), Positives = 117/134 (87%), Gaps = 6/134 (4%)

Query: 1   ACGLVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNLC---NPRFNAHGDVNTIVC 57
           ACGLVASNLNLKPGE LRVRGEVA DAKSF+LNLGKD NNLC   NPRFNAHGD NTIVC
Sbjct: 1   ACGLVASNLNLKPGEXLRVRGEVAPDAKSFVLNLGKDSNNLCLHFNPRFNAHGDANTIVC 60

Query: 58  NSKDAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYL 114
           NSKD GAWG EQRE+ FPFQPGSV EV   F+Q +LT+KLPDGYEFKFPN LNLEAINY+
Sbjct: 61  NSKDGGAWGTEQREAVFPFQPGSVAEVCITFDQANLTVKLPDGYEFKFPNHLNLEAINYM 120

Query: 115 SAGGDFKIKCVAFE 128
           +A GDFKIKCVAF+
Sbjct: 121 AADGDFKIKCVAFD 134


>ref|XP_001161991.1| PREDICTED: hypothetical protein isoform 1 [Pan troglodytes]
          Length = 128

 Score =  213 bits (542), Expect = 4e-54,   Method: Composition-based stats.
 Identities = 108/131 (82%), Positives = 115/131 (87%), Gaps = 7/131 (5%)

Query: 1   ACGLVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNLC---NPRFNAHGDVNTIVC 57
           ACGLVASNLNLKPGECLRVRGEVA DAKSF+LNLGKD NNLC   NPRFNAHGD NTIVC
Sbjct: 2   ACGLVASNLNLKPGECLRVRGEVAPDAKSFVLNLGKDSNNLCLHFNPRFNAHGDANTIVC 61

Query: 58  NSKDAGAWGAEQRESAFPFQPGSVVEVFNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAG 117
           NSKD GAWG EQRE+ FPFQPGSV E     +LT+KLPDGYEFKFPNRLNLEAINY++A 
Sbjct: 62  NSKDGGAWGTEQREAVFPFQPGSVAE----ANLTVKLPDGYEFKFPNRLNLEAINYMAAD 117

Query: 118 GDFKIKCVAFE 128
           GDFKIKCVAF+
Sbjct: 118 GDFKIKCVAFD 128


>pdb|1W6M|A Chain A, X-Ray Crystal Structure Of C2s Human Galectin-1 Complexed
           With Galactose
 pdb|1W6N|A Chain A, X-Ray Crystal Structure Of C2s Human Galectin-1
 pdb|1W6O|A Chain A, X-Ray Crystal Structure Of C2s Human Galectin-1 Complexed
           With Lactose
 pdb|1W6P|A Chain A, X-Ray Crystal Structure Of C2s Human Galectin-1 Complexed
           With N-Acetyl-Lactosamine
          Length = 134

 Score =  213 bits (541), Expect = 5e-54,   Method: Composition-based stats.
 Identities = 109/134 (81%), Positives = 117/134 (87%), Gaps = 6/134 (4%)

Query: 1   ACGLVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNLC---NPRFNAHGDVNTIVC 57
           A GLVASNLNLKPGE LRVRGEVA DAKSF+LNLGKD NNLC   NPRFNAHGD NTIVC
Sbjct: 1   ASGLVASNLNLKPGEXLRVRGEVAPDAKSFVLNLGKDSNNLCLHFNPRFNAHGDANTIVC 60

Query: 58  NSKDAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYL 114
           NSKD GAWG EQRE+ FPFQPGSV EV   F+Q +LT+KLPDGYEFKFPNRLNLEAINY+
Sbjct: 61  NSKDDGAWGTEQREAVFPFQPGSVAEVCITFDQANLTVKLPDGYEFKFPNRLNLEAINYM 120

Query: 115 SAGGDFKIKCVAFE 128
           +A GDFKIKCVAF+
Sbjct: 121 AADGDFKIKCVAFD 134


>ref|XP_001083299.1| PREDICTED: lectin, galactoside-binding, soluble, 1 (galectin 1)
           isoform 1 [Macaca mulatta]
          Length = 125

 Score =  209 bits (533), Expect = 5e-53,   Method: Composition-based stats.
 Identities = 108/131 (82%), Positives = 113/131 (86%), Gaps = 10/131 (7%)

Query: 1   ACGLVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNLC---NPRFNAHGDVNTIVC 57
           ACGLVASNLNLKPGECLRVRGEVA DAKSF+LNLGKD NNLC   NPRFNA GD NTIVC
Sbjct: 2   ACGLVASNLNLKPGECLRVRGEVAPDAKSFVLNLGKDSNNLCLHFNPRFNAQGDANTIVC 61

Query: 58  NSKDAGAWGAEQRESAFPFQPGSVVEVFNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAG 117
           NSKD GAWG EQRE+AFPFQPGS        DLTIKLPDGYEFKFPNRLNLEAINY++A 
Sbjct: 62  NSKDGGAWGTEQREAAFPFQPGS-------ADLTIKLPDGYEFKFPNRLNLEAINYMAAD 114

Query: 118 GDFKIKCVAFE 128
           GDFKIKCVAF+
Sbjct: 115 GDFKIKCVAFD 125


>ref|XP_852831.1| PREDICTED: similar to Galectin-1 (Beta-galactoside-binding lectin
           L-14-I) (Lactose-binding lectin 1) (S-Lac lectin 1)
           (Galaptin) (14 kDa lectin) (HPL) (HBL) (MAPK activating
           protein MP12) [Canis familiaris]
          Length = 135

 Score =  207 bits (526), Expect = 3e-52,   Method: Composition-based stats.
 Identities = 103/134 (76%), Positives = 115/134 (85%), Gaps = 6/134 (4%)

Query: 1   ACGLVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNLC---NPRFNAHGDVNTIVC 57
           ACGLVASNL+LKPG+CLRV+ EV  +AKSF+LNLGKD +NLC   NPRF AHGDVNTIVC
Sbjct: 2   ACGLVASNLSLKPGQCLRVQCEVVPEAKSFVLNLGKDGDNLCLHFNPRFEAHGDVNTIVC 61

Query: 58  NSKDAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYL 114
           NSKD GAWG E RESAFPFQPG+V EV   F+Q DLTIKLPDGY FKFPNRLNLEAI+YL
Sbjct: 62  NSKDGGAWGEELRESAFPFQPGTVTEVCISFDQADLTIKLPDGYTFKFPNRLNLEAISYL 121

Query: 115 SAGGDFKIKCVAFE 128
           +A GD KIKC+AF+
Sbjct: 122 AADGDMKIKCLAFD 135


>ref|XP_549042.2| PREDICTED: similar to Galectin-1 (Beta-galactoside-binding lectin
           L-14-I) (Lactose-binding lectin 1) (S-Lac lectin 1)
           (Galaptin) (14 kDa lectin) (HPL) (HBL) (MAPK activating
           protein MP12) [Canis familiaris]
          Length = 281

 Score =  205 bits (522), Expect = 8e-52,   Method: Composition-based stats.
 Identities = 101/134 (75%), Positives = 113/134 (84%), Gaps = 6/134 (4%)

Query: 1   ACGLVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNLC---NPRFNAHGDVNTIVC 57
           ACGLVASNL+LKPG+CLRV+ EV  +AKSF+LNLGKD +NLC   NPRF AH DVNTIVC
Sbjct: 148 ACGLVASNLSLKPGQCLRVQCEVVPEAKSFVLNLGKDGDNLCLHFNPRFEAHSDVNTIVC 207

Query: 58  NSKDAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYL 114
           NSKD GA G E RESAFPFQPG+V EV   F+Q DLTIKLPDGY FKFPNRLNLEAI+YL
Sbjct: 208 NSKDGGARGEEHRESAFPFQPGTVTEVCISFDQADLTIKLPDGYTFKFPNRLNLEAISYL 267

Query: 115 SAGGDFKIKCVAFE 128
           +A GD KIKC+AF+
Sbjct: 268 AADGDMKIKCLAFD 281


>pdb|2ZKN|A Chain A, X-Ray Structure Of Mutant Galectin-1LACTOSE COMPLEX
 pdb|2ZKN|B Chain B, X-Ray Structure Of Mutant Galectin-1LACTOSE COMPLEX
          Length = 134

 Score =  205 bits (521), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 106/134 (79%), Positives = 114/134 (85%), Gaps = 6/134 (4%)

Query: 1   ACGLVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNLC---NPRFNAHGDVNTIVC 57
           A GLVASNLNLKPGE LRVRGEVA DAKSF+LNLGKD NNL    NPRFNAHGD NTIV 
Sbjct: 1   ASGLVASNLNLKPGESLRVRGEVAPDAKSFVLNLGKDSNNLSLHFNPRFNAHGDANTIVS 60

Query: 58  NSKDAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYL 114
           NSKD GAWG EQRE+ FPFQPGSV EV   F+Q +LT+KLPDGYEFKFPNRLNLEAINY+
Sbjct: 61  NSKDGGAWGTEQREAVFPFQPGSVAEVSITFDQANLTVKLPDGYEFKFPNRLNLEAINYM 120

Query: 115 SAGGDFKIKCVAFE 128
           +A GDFKIK VAF+
Sbjct: 121 AADGDFKIKSVAFD 134


>dbj|BAC56336.1| similar to galactose-binding lectin [Bos taurus]
          Length = 114

 Score =  202 bits (514), Expect = 7e-51,   Method: Composition-based stats.
 Identities = 106/114 (92%), Positives = 106/114 (92%), Gaps = 6/114 (5%)

Query: 21  GEVAADAKSFLLNLGKDDNNLC---NPRFNAHGDVNTIVCNSKDAGAWGAEQRESAFPFQ 77
           G  AADAKSFLLNLGKDDNNLC   NPRFNAHGDVNTIVCNSKDAGAWGAEQRESAFPFQ
Sbjct: 1   GRGAADAKSFLLNLGKDDNNLCLHFNPRFNAHGDVNTIVCNSKDAGAWGAEQRESAFPFQ 60

Query: 78  PGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFKIKCVAFE 128
           PGSVVEV   FNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFKIKCVAFE
Sbjct: 61  PGSVVEVCISFNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFKIKCVAFE 114


>ref|XP_001510347.1| PREDICTED: similar to Galectin-1 (Lectin galactoside-binding
           soluble 1) (Beta-galactoside-binding lectin L-14-I)
           (Lactose-binding lectin 1) (S-Lac lectin 1) (Galaptin)
           (14 kDa lectin) (RL 14.5) [Ornithorhynchus anatinus]
          Length = 249

 Score =  200 bits (508), Expect = 4e-50,   Method: Composition-based stats.
 Identities = 98/132 (74%), Positives = 112/132 (84%), Gaps = 6/132 (4%)

Query: 3   GLVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNLC---NPRFNAHGDVNTIVCNS 59
           GLVA+NLNLK GEC++V+G+VA  AKSF+LNLGKD+ NLC   NPRF+ HGDVNTIVCNS
Sbjct: 118 GLVATNLNLKAGECVKVKGDVAPGAKSFVLNLGKDNANLCLHFNPRFDIHGDVNTIVCNS 177

Query: 60  KDAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYLSA 116
           KD G WG EQRE+AFPF PGS  EV   F+QT+LT+KLPDG  FKFPNRLNL+AINYL+A
Sbjct: 178 KDEGVWGKEQRETAFPFLPGSPAEVCVSFDQTELTVKLPDGQAFKFPNRLNLDAINYLAA 237

Query: 117 GGDFKIKCVAFE 128
            GDFKIKCVAFE
Sbjct: 238 EGDFKIKCVAFE 249


>dbj|BAC56513.1| similar to galactose-binding lectin [Bos taurus]
          Length = 104

 Score =  185 bits (470), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 97/103 (94%), Positives = 97/103 (94%), Gaps = 6/103 (5%)

Query: 1   ACGLVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNLC---NPRFNAHGDVNTIVC 57
           ACGLVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNLC   NPRFNAHGDVNTIVC
Sbjct: 2   ACGLVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNLCLHFNPRFNAHGDVNTIVC 61

Query: 58  NSKDAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDG 97
           NSKDAGAWGAEQRESAFPFQPGSVVEV   FNQTDLTIKLPDG
Sbjct: 62  NSKDAGAWGAEQRESAFPFQPGSVVEVCISFNQTDLTIKLPDG 104


>dbj|BAC56327.1| similar to galactose-binding lectin [Bos taurus]
          Length = 102

 Score =  184 bits (466), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 94/102 (92%), Positives = 95/102 (93%), Gaps = 6/102 (5%)

Query: 33  NLGKDDNNLC---NPRFNAHGDVNTIVCNSKDAGAWGAEQRESAFPFQPGSVVEV---FN 86
           +LGKDDNNLC   NPRFNAHGDVNTIVC SKDAGAWGAEQRESAFPFQPGSVVEV   FN
Sbjct: 1   SLGKDDNNLCLHFNPRFNAHGDVNTIVCXSKDAGAWGAEQRESAFPFQPGSVVEVCISFN 60

Query: 87  QTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFKIKCVAFE 128
           QTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFKIKCVAFE
Sbjct: 61  QTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFKIKCVAFE 102


>dbj|BAC56326.1| similar to galactose-binding lectin [Bos taurus]
          Length = 95

 Score =  174 bits (442), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 89/95 (93%), Positives = 89/95 (93%), Gaps = 6/95 (6%)

Query: 40  NLC---NPRFNAHGDVNTIVCNSKDAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIK 93
           NLC   NPRFNAHGDVNTIVCNSKDAGAWGAEQRESAFPFQPGSVVEV   FNQTDLTIK
Sbjct: 1   NLCLHFNPRFNAHGDVNTIVCNSKDAGAWGAEQRESAFPFQPGSVVEVCISFNQTDLTIK 60

Query: 94  LPDGYEFKFPNRLNLEAINYLSAGGDFKIKCVAFE 128
           LPDGYEFKFPNRLNLEAINYLSAGGDFKIKCVAFE
Sbjct: 61  LPDGYEFKFPNRLNLEAINYLSAGGDFKIKCVAFE 95


>emb|CAA36183.1| unnamed protein product [Mus musculus]
          Length = 107

 Score =  169 bits (427), Expect = 8e-41,   Method: Composition-based stats.
 Identities = 83/106 (78%), Positives = 91/106 (85%), Gaps = 6/106 (5%)

Query: 1   ACGLVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNLC---NPRFNAHGDVNTIVC 57
           ACGLVASNLNLKPGECL+VRGEVA+DAKSF+LNLGKD NNLC   NPRFNAHGD NTIVC
Sbjct: 2   ACGLVASNLNLKPGECLKVRGEVASDAKSFVLNLGKDSNNLCLHFNPRFNAHGDANTIVC 61

Query: 58  NSKDAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEF 100
           N+K+ G WG E RE AFPFQPGS+ EV   F+Q DLTIKLPDG+EF
Sbjct: 62  NTKEDGTWGTEHREPAFPFQPGSITEVCITFDQADLTIKLPDGHEF 107


>ref|XP_001376589.1| PREDICTED: similar to Chain B, X-Ray Crystal Structure Of C2s Human
           Galectin-1 Complexed With Galactose [Monodelphis
           domestica]
          Length = 209

 Score =  162 bits (409), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 80/131 (61%), Positives = 98/131 (74%), Gaps = 6/131 (4%)

Query: 4   LVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNLC---NPRFNAHGDVNTIVCNSK 60
           ++ASNLNLKPG C+R+ G+V  DAKSF LNLGKD  NL    NPRF+   D N IVCNS+
Sbjct: 79  ILASNLNLKPGVCVRIVGDVLPDAKSFRLNLGKDHENLALHFNPRFDCFDDTNVIVCNSR 138

Query: 61  DAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAG 117
             G+WGAEQRE++FPF PGS VEV   F  +  T++LPDG EFKFPNRLNL+ IN+L A 
Sbjct: 139 QEGSWGAEQRETSFPFLPGSQVEVCFAFEGSHFTVRLPDGSEFKFPNRLNLDTINFLEAN 198

Query: 118 GDFKIKCVAFE 128
           GDFK++ V F+
Sbjct: 199 GDFKLRSVNFD 209


>ref|XP_002195307.1| PREDICTED: galectin CG-16 [Taeniopygia guttata]
          Length = 134

 Score =  152 bits (385), Expect = 7e-36,   Method: Composition-based stats.
 Identities = 70/131 (53%), Positives = 98/131 (74%), Gaps = 7/131 (5%)

Query: 3   GLVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNLC---NPRFNAHGDVNTIVCNS 59
           GLV + L+++PGEC++V+G++ +DAK F +N+GKD N L    NPRF+ HGDVNT+VCNS
Sbjct: 4   GLVVTQLDVEPGECIKVKGKIQSDAKGFAVNVGKDSNTLMLHFNPRFDCHGDVNTVVCNS 63

Query: 60  KDAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYLSA 116
           K+ G WG E R++ FPFQ G  +E+   F++T+ T+KLP+  EFKFPNRL +E I YL+ 
Sbjct: 64  KEDGVWGEEDRKAEFPFQHGDKIEICISFDETEATVKLPEA-EFKFPNRLGMEKIEYLAV 122

Query: 117 GGDFKIKCVAF 127
            GDFK+K + F
Sbjct: 123 EGDFKVKAIKF 133


>gb|ACH44734.1| putative galectin CG-16 [Taeniopygia guttata]
          Length = 134

 Score =  147 bits (370), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 69/131 (52%), Positives = 95/131 (72%), Gaps = 7/131 (5%)

Query: 3   GLVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNLC---NPRFNAHGDVNTIVCNS 59
           GLV    +++PGEC++V+G++ +DAK F +N+GKD N L    NPRF+ HGDVNTIVCNS
Sbjct: 4   GLVVIQRDVEPGECIKVKGKIQSDAKGFAVNVGKDSNTLMLHFNPRFDCHGDVNTIVCNS 63

Query: 60  KDAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYLSA 116
           K+ G WG E R++ FPFQ G  +E+   F++ + T+KLP+  EFKFPNRL +E I YL+ 
Sbjct: 64  KEDGVWGEEDRKADFPFQHGDKIEICISFDEAEATVKLPEA-EFKFPNRLGMEKIEYLAV 122

Query: 117 GGDFKIKCVAF 127
            GDFK+K + F
Sbjct: 123 EGDFKVKAIKF 133


>dbj|BAC56536.1| similar to galactose-binding lectin [Bos taurus]
          Length = 76

 Score =  144 bits (364), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 71/74 (95%), Positives = 71/74 (95%), Gaps = 3/74 (4%)

Query: 43  NPRFNAHGDVNTIVCNSKDAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYE 99
           NPRFNAHGDVNTIVCNSKDAGAWGAEQRESAFPFQPGSVVEV   FNQTDLTIKLPDGYE
Sbjct: 3   NPRFNAHGDVNTIVCNSKDAGAWGAEQRESAFPFQPGSVVEVCISFNQTDLTIKLPDGYE 62

Query: 100 FKFPNRLNLEAINY 113
           FKFPNRLNLEAINY
Sbjct: 63  FKFPNRLNLEAINY 76


>ref|NP_996788.1| galectin CG-16 [Gallus gallus]
 sp|P23668|LEG6_CHICK RecName: Full=16 kDa beta-galactoside-binding lectin; AltName:
           Full=C-16; AltName: Full=Galectin CG-16
 gb|AAS59560.1| galectin CG-16 [Gallus gallus]
          Length = 134

 Score =  144 bits (362), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 66/131 (50%), Positives = 96/131 (73%), Gaps = 7/131 (5%)

Query: 3   GLVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNLC---NPRFNAHGDVNTIVCNS 59
           GLV + L+++PGEC++V+G++ +DAK F +N+GKD + L    NPRF+ HGDVNT+VCNS
Sbjct: 4   GLVVTQLDVQPGECVKVKGKILSDAKGFSVNVGKDSSTLMLHFNPRFDCHGDVNTVVCNS 63

Query: 60  KDAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYLSA 116
           K+ G WG E R++ FPFQ G  VE+   F+  ++ +K+P+  EF+FPNRL +E I YL+ 
Sbjct: 64  KEDGTWGEEDRKADFPFQQGDKVEICISFDAAEVKVKVPE-VEFEFPNRLGMEKIQYLAV 122

Query: 117 GGDFKIKCVAF 127
            GDFK+K + F
Sbjct: 123 EGDFKVKAIKF 133


>ref|NP_990826.1| galectin-1 [Gallus gallus]
 sp|P07583|LEG4_CHICK RecName: Full=Beta-galactoside-binding lectin; AltName: Full=14 kDa
           lectin; AltName: Full=C-14
 gb|AAA48779.1| 14K beta-galactoside-binding lectin
 dbj|BAA00214.1| 14K beta-galactoside-binding lectin [Gallus gallus]
 prf||1410238A beta galactoside binding lectin
          Length = 135

 Score =  143 bits (361), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 70/132 (53%), Positives = 92/132 (69%), Gaps = 7/132 (5%)

Query: 3   GLVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNL---CNPRFNAHGDVNTIVCNS 59
           G V +NL LKPG+ L V+G +A +AKSF++NLGKD  +L    NPRF+AHGDVN IVCNS
Sbjct: 5   GPVCTNLGLKPGQRLTVKGIIAPNAKSFVMNLGKDSTHLGLHFNPRFDAHGDVNLIVCNS 64

Query: 60  KDAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYLSA 116
           K    WG EQRE+ FPFQ G+ +E+    N +DLT+ LP G++F FPNRL L   +Y   
Sbjct: 65  KKMEEWGTEQRETVFPFQKGAPIEITFSINPSDLTVHLP-GHQFSFPNRLGLSVFDYFDT 123

Query: 117 GGDFKIKCVAFE 128
            GDF ++ V++E
Sbjct: 124 HGDFTLRSVSWE 135


>pdb|1QMJ|A Chain A, Cg-16, A Homodimeric Agglutinin From Chicken Liver
 pdb|1QMJ|B Chain B, Cg-16, A Homodimeric Agglutinin From Chicken Liver
          Length = 132

 Score =  143 bits (361), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 66/131 (50%), Positives = 96/131 (73%), Gaps = 7/131 (5%)

Query: 3   GLVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNLC---NPRFNAHGDVNTIVCNS 59
           GLV + L+++PGEC++V+G++ +DAK F +N+GKD + L    NPRF+ HGDVNT+VCNS
Sbjct: 2   GLVVTQLDVQPGECVKVKGKILSDAKGFSVNVGKDSSTLMLHFNPRFDCHGDVNTVVCNS 61

Query: 60  KDAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYLSA 116
           K+ G WG E R++ FPFQ G  VE+   F+  ++ +K+P+  EF+FPNRL +E I YL+ 
Sbjct: 62  KEDGTWGEEDRKADFPFQQGDKVEICISFDAAEVKVKVPE-VEFEFPNRLGMEKIQYLAV 120

Query: 117 GGDFKIKCVAF 127
            GDFK+K + F
Sbjct: 121 EGDFKVKAIKF 131


>prf||1304250A lectin,beta galactoside binding
          Length = 134

 Score =  143 bits (360), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 70/132 (53%), Positives = 92/132 (69%), Gaps = 7/132 (5%)

Query: 3   GLVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNL---CNPRFNAHGDVNTIVCNS 59
           G V +NL LKPG+ L V+G +A +AKSF++NLGKD  +L    NPRF+AHGDVN IVCNS
Sbjct: 4   GPVCTNLGLKPGQRLTVKGIIAPNAKSFVMNLGKDSTHLGLHFNPRFDAHGDVNLIVCNS 63

Query: 60  KDAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYLSA 116
           K    WG EQRE+ FPFQ G+ +E+    N +DLT+ LP G++F FPNRL L   +Y   
Sbjct: 64  KKMEEWGTEQRETVFPFQKGAPIEITFSINPSDLTVHLP-GHQFSFPNRLGLSVFDYFDT 122

Query: 117 GGDFKIKCVAFE 128
            GDF ++ V++E
Sbjct: 123 HGDFTLRSVSWE 134


>pir||B28302 beta-galactoside-binding lectin, placental - human  (fragments)
          Length = 110

 Score =  139 bits (351), Expect = 6e-32,   Method: Composition-based stats.
 Identities = 77/109 (70%), Positives = 83/109 (76%), Gaps = 13/109 (11%)

Query: 21  GEVAADAKSFLLNLGKDDNNLC---NPRFNAHGDVNTIVCNSKDAGAWGAEQRESAFPFQ 77
           GEVA DAKSF+LNLGKD NNLC   NPRFNAHGD N       D GAWG EQRE+ FPFQ
Sbjct: 9   GEVAPDAKSFVLNLGKDSNNLCLHFNPRFNAHGDAN-------DGGAWGTEQREAVFPFQ 61

Query: 78  PGSVVEV--FNQTDL-TIKLPDGYEFKFPNRLNLEAINYLSAGGDFKIK 123
           PGSV EV  F+Q +L  I LPDG EFKFPNRLNLEAIN ++A GDFKIK
Sbjct: 62  PGSVAEVITFDQANLLVIILPDGLEFKFPNRLNLEAINLMAADGDFKIK 110


>gb|ACH44733.1| putative galectin CG-16 [Taeniopygia guttata]
          Length = 135

 Score =  131 bits (330), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 62/125 (49%), Positives = 88/125 (70%), Gaps = 7/125 (5%)

Query: 9   LNLKPGECLRVRGEVAADAKSFLLNLGKDDNNLC---NPRFNAHGDVNTIVCNSKDAGAW 65
           ++++PGEC++V+G++  DAK F +N+GKD N L    NPRF+  GDVNT VCNSK+ G W
Sbjct: 11  VDVEPGECIKVKGKIQFDAKGFAVNVGKDSNTLMLHFNPRFDCQGDVNTFVCNSKEDGVW 70

Query: 66  GAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFKI 122
           G E R++ FPFQ G  +E+   F++ +  +K P+  EFKFPNRL +E I YL+  GDFK+
Sbjct: 71  GEEDRKADFPFQHGDKIEICFSFDEAEAPVKFPEA-EFKFPNRLGMEKIEYLAVEGDFKV 129

Query: 123 KCVAF 127
           K + F
Sbjct: 130 KAIKF 134


>ref|NP_001079039.1| galectin-Ia [Xenopus laevis]
 dbj|BAB83247.1| galectin family xgalectin-Ia [Xenopus laevis]
 gb|AAI28963.1| Lgalsia-a protein [Xenopus laevis]
          Length = 134

 Score =  125 bits (314), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 60/124 (48%), Positives = 80/124 (64%), Gaps = 6/124 (4%)

Query: 1   ACGLVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNLC---NPRFNAHGDVNTIVC 57
           + G+V SN +LK G CL ++G +  DAKSF +NLGKD +N     NPRF+ HGD N I+C
Sbjct: 2   SAGMVMSNFSLKQGHCLELKGIIPKDAKSFAINLGKDSSNYVIHFNPRFDHHGDTNKIIC 61

Query: 58  NSKDAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYL 114
           NSK+   WG EQRE+AFPFQ G+   +   +    L +KL DG EF FP R+ L+ I +L
Sbjct: 62  NSKEENHWGKEQRENAFPFQQGAETTICFEYQADHLKVKLSDGKEFNFPIRMPLDTITFL 121

Query: 115 SAGG 118
           +  G
Sbjct: 122 TMDG 125


>gb|AAA48626.1| 16 kDa beta-galactoside-binding lectin
          Length = 117

 Score =  124 bits (312), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 58/115 (50%), Positives = 85/115 (73%), Gaps = 7/115 (6%)

Query: 3   GLVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNLC---NPRFNAHGDVNTIVCNS 59
           GLV + L+++PGEC++V+G++ +DAK F +N+GKD + L    NPRF+ HGDVNT+VCNS
Sbjct: 4   GLVVTQLDVQPGECVKVKGKILSDAKGFSVNVGKDSSTLMLHFNPRFDCHGDVNTVVCNS 63

Query: 60  KDAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAI 111
           K+ G WG E R++ FPFQ G  VE+   F+  ++ +K+P+  EF+FPNRL +E I
Sbjct: 64  KEDGTWGEEDRKADFPFQQGDKVEICISFDAAEVKVKVPE-VEFEFPNRLGMEKI 117


>ref|NP_001079744.1| hypothetical protein LOC379433 [Xenopus laevis]
 gb|AAK11514.1| galectin-1 [Xenopus laevis]
 dbj|BAB83256.1| galectin family xgalectin-Ib [Xenopus laevis]
 gb|AAH53816.1| MGC64502 protein [Xenopus laevis]
          Length = 134

 Score =  122 bits (305), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 59/124 (47%), Positives = 79/124 (63%), Gaps = 6/124 (4%)

Query: 1   ACGLVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNLC---NPRFNAHGDVNTIVC 57
           A G+V +N +LK G CL ++G +  DAKSF +NLGKD +N     NPRF+  GD N I+C
Sbjct: 2   AAGMVMNNFSLKQGHCLELKGFIPKDAKSFAINLGKDSSNYVIHFNPRFDHEGDTNKIIC 61

Query: 58  NSKDAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYL 114
           NSK+  +WG EQRE+ FPFQ G+   +   +    L +KL DG EF FP R+ L+ I +L
Sbjct: 62  NSKEENSWGTEQRENVFPFQQGAETSICFEYQADHLKVKLSDGQEFNFPIRMPLDTITFL 121

Query: 115 SAGG 118
           S  G
Sbjct: 122 SMDG 125


>sp|P56217|LEG1_BUFAR RecName: Full=Galectin-1
 pdb|1A78|A Chain A, Complex Of Toad Ovary Galectin With Thio-Digalactose
 pdb|1A78|B Chain B, Complex Of Toad Ovary Galectin With Thio-Digalactose
          Length = 134

 Score =  116 bits (291), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 59/124 (47%), Positives = 78/124 (62%), Gaps = 6/124 (4%)

Query: 1   ACGLVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNLC---NPRFNAHGDVNTIVC 57
           + G+  +NLNLKPG C+ ++G +  D K F +NLG+D +N     N RF+ HGDVN IVC
Sbjct: 2   SAGVAVTNLNLKPGHCVEIKGSIPPDCKGFAVNLGEDASNFLLHFNARFDLHGDVNKIVC 61

Query: 58  NSKDAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYL 114
           NSK+A AWG+EQRE  FPFQ G+ V V   +    + IK   G +F FP R  L +I +L
Sbjct: 62  NSKEADAWGSEQREEVFPFQQGAEVMVCFEYQTQKIIIKFSSGDQFSFPVRKVLPSIPFL 121

Query: 115 SAGG 118
           S  G
Sbjct: 122 SLEG 125


>pdb|1GAN|A Chain A, Complex Of Toad Ovary Galectin With N-Acetylgalactose
 pdb|1GAN|B Chain B, Complex Of Toad Ovary Galectin With N-Acetylgalactose
          Length = 134

 Score =  116 bits (290), Expect = 7e-25,   Method: Composition-based stats.
 Identities = 62/124 (50%), Positives = 80/124 (64%), Gaps = 6/124 (4%)

Query: 1   ACGLVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNLC---NPRFNAHGDVNTIVC 57
           + G+  +NLNLKPG C+ ++G +  D K F +NLG+D +N     N RF+ HGDVN IVC
Sbjct: 2   SAGVAVTNLNLKPGHCVEIKGSIPPDCKGFAVNLGEDASNFLLHFNARFDLHGDVNKIVC 61

Query: 58  NSKDAGAWGAEQRESAFPFQPGSVVEVF--NQTD-LTIKLPDGYEFKFPNRLNLEAINYL 114
           NSK+A AWG+EQRE  FPFQ G+ V V    QTD + IK   G +F FP R  L +I +L
Sbjct: 62  NSKEADAWGSEQREGVFPFQQGAEVMVCFEYQTDKIIIKFSSGDQFSFPVRKVLPSIPFL 121

Query: 115 SAGG 118
           S  G
Sbjct: 122 SLEG 125


>gb|AAH27504.1| Lgals2 protein [Mus musculus]
          Length = 130

 Score =  108 bits (269), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 51/114 (44%), Positives = 71/114 (62%), Gaps = 4/114 (3%)

Query: 8   NLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGA 67
           +LN+KPG  L+++G++  D   FL+NLG+    L N  FN   D +TIVCN+ + G WG 
Sbjct: 9   DLNMKPGMSLKIKGKIHNDVDRFLINLGQGKETL-NLHFNPRFDESTIVCNTSEGGRWGQ 67

Query: 68  EQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGG 118
           EQRE+   F PGS V++   F   D  + LPDG++  FPNRL    ++YLS GG
Sbjct: 68  EQRENHMCFSPGSEVKITITFQDKDFKVTLPDGHQLTFPNRLGHSQLHYLSMGG 121


>sp|Q9CQW5|LEG2_MOUSE RecName: Full=Galectin-2
 dbj|BAB24987.1| unnamed protein product [Mus musculus]
 dbj|BAB25797.1| unnamed protein product [Mus musculus]
          Length = 130

 Score =  107 bits (267), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 51/114 (44%), Positives = 71/114 (62%), Gaps = 4/114 (3%)

Query: 8   NLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGA 67
           +LN+KPG  L+++G++  D   FL+NLG+    L N  FN   D +TIVCN+ + G WG 
Sbjct: 9   DLNMKPGMSLKIKGKIHNDVDRFLINLGQGKETL-NLHFNPRFDESTIVCNTSEGGRWGQ 67

Query: 68  EQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGG 118
           EQRE+   F PGS V++   F   D  + LPDG++  FPNRL    ++YLS GG
Sbjct: 68  EQRENHMCFSPGSEVKITITFQDKDFKVTLPDGHQLTFPNRLGHNQLHYLSMGG 121


>gb|AAA36172.1| beta-galactoside-binding lectin
          Length = 67

 Score =  105 bits (263), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 47/62 (75%), Positives = 53/62 (85%), Gaps = 3/62 (4%)

Query: 65  WGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFK 121
           WG E RE AFPFQPGS+ EV   F+Q DLTIKLPDG+EFKFPNRLN+EAINY++A GDFK
Sbjct: 2   WGTEHREPAFPFQPGSITEVCITFDQADLTIKLPDGHEFKFPNRLNMEAINYMAADGDFK 61

Query: 122 IK 123
           IK
Sbjct: 62  IK 63


>ref|NP_079898.1| lectin, galactose-binding, soluble 2 [Mus musculus]
 dbj|BAB25806.1| unnamed protein product [Mus musculus]
          Length = 130

 Score =  105 bits (262), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 54/117 (46%), Positives = 74/117 (63%), Gaps = 10/117 (8%)

Query: 8   NLNLKPGECLRVRGEVAADAKSFLLNL--GKDDNNL-CNPRFNAHGDVNTIVCNSKDAGA 64
           +LN+KPG  L+++G++  D   FL+NL  GK+  NL  NPRF    D +TIVCN+ + G 
Sbjct: 9   DLNMKPGMSLKIKGKIHNDVDRFLINLVQGKETLNLHFNPRF----DESTIVCNTSEGGR 64

Query: 65  WGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGG 118
           WG EQRE+   F PGS V++   F   D  + LPDG++  FPNRL    ++YLS GG
Sbjct: 65  WGQEQRENHMCFSPGSEVKITITFQDKDFKVTLPDGHQLTFPNRLGHNQLHYLSMGG 121


>gb|AAA37313.1| 14 kDa beta-galactoside-binding lectin (L-14.5)
          Length = 106

 Score =  105 bits (261), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 53/100 (53%), Positives = 66/100 (66%), Gaps = 7/100 (7%)

Query: 1   ACGLVASNLNLKPGECLRVRGEV-AADAKSFLLNLGKDDNNLC---NPRFNAHGDVNTIV 56
           ACGLV      + G   +  G+   +D +SF+L LGKD NN C   NPRFNAHGD NTI+
Sbjct: 2   ACGLVDQQAESQTGAMSQSSGQRWTSDDRSFVLTLGKDSNNRCLHFNPRFNAHGDANTIL 61

Query: 57  CNSKDAGAWGAEQRESAFPFQPGSVVE---VFNQTDLTIK 93
           CN+K+ G WG E RE AFPFQPGS+ E    F+Q DLT++
Sbjct: 62  CNTKEDGTWGTEHREPAFPFQPGSITECACTFDQADLTMQ 101


>dbj|BAB25661.1| unnamed protein product [Mus musculus]
          Length = 130

 Score =  103 bits (258), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 50/114 (43%), Positives = 70/114 (61%), Gaps = 4/114 (3%)

Query: 8   NLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGA 67
           +LN+KPG  L+++G++  D   FL+NLG+    L N  FN   D +TIVCN+ + G WG 
Sbjct: 9   DLNMKPGMSLKIKGKIHNDVDRFLINLGQGKETL-NLHFNPRFDESTIVCNTSEGGRWGQ 67

Query: 68  EQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGG 118
           EQRE+   F PGS V++   F   D  + LPDG++  F NRL    ++YLS GG
Sbjct: 68  EQRENHMCFSPGSEVKITITFQDKDFKVTLPDGHQLTFRNRLGHNQLHYLSMGG 121


>ref|NP_001136314.1| lectin, galactoside-binding, soluble, 3 [Sus scrofa]
 gb|ACJ64061.1| lectin galactoside-binding soluble 2 protein [Sus scrofa]
          Length = 131

 Score =  103 bits (257), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 51/121 (42%), Positives = 76/121 (62%), Gaps = 10/121 (8%)

Query: 8   NLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNLC---NPRFNAHGDVNTIVCNSKDAGA 64
           N+++K G+ L+++G++  DA  F++NLG+  + L    NPRF      +TIVCNS+D  +
Sbjct: 9   NMDMKVGKTLKIKGKIDDDADGFVINLGQGTDKLALHFNPRFGE----STIVCNSRDGNS 64

Query: 65  WGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFK 121
           WG EQR+S   F PGS V++   F +    +KLPDG++  FPNRL    ++YLS  G F 
Sbjct: 65  WGKEQRDSHMCFSPGSEVKLIVTFEEDGFKVKLPDGHQLTFPNRLGYSHLSYLSVQGGFN 124

Query: 122 I 122
           I
Sbjct: 125 I 125


>ref|NP_001135709.1| hypothetical protein LOC100216286 [Xenopus (Silurana) tropicalis]
 gb|AAI68834.1| Unknown (protein for MGC:189054) [Xenopus tropicalis]
          Length = 135

 Score =  102 bits (255), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 53/114 (46%), Positives = 70/114 (61%), Gaps = 5/114 (4%)

Query: 7   SNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNL---CNPRFNAHGDVNTIVCNSKDAG 63
           +NL+L  G  + VRG +  D K F +++G D  NL   CNPRF    D NTI+ NSK  G
Sbjct: 10  TNLSLHKGHRVEVRGRILKDTKRFAVDMGADAENLIMHCNPRFEFSVDKNTIIFNSKQNG 69

Query: 64  AWGAEQRESAFPFQPGS-VVEVFNQTD-LTIKLPDGYEFKFPNRLNLEAINYLS 115
            WG EQ+E+AFPFQ GS  + +F   D +T+ LPDG E  F  R  ++ INYL+
Sbjct: 70  VWGTEQKETAFPFQAGSETMLIFEFEDCITVLLPDGTEVPFTCRFPIDVINYLA 123


>ref|NP_001116913.1| lectin, galactoside-binding, soluble, 2 [Xenopus (Silurana)
           tropicalis]
 gb|AAI61334.1| Lgals2 protein [Xenopus tropicalis]
          Length = 131

 Score =  102 bits (253), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 53/124 (42%), Positives = 74/124 (59%), Gaps = 4/124 (3%)

Query: 8   NLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGA 67
           NL LK GE L+++G ++ +AK+F  NLGK   ++    FN     NTIVCNSK +  W +
Sbjct: 9   NLELKRGESLKIKGALSGNAKNFSFNLGKSATDI-GLHFNPRLHENTIVCNSKRSNNWES 67

Query: 68  EQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFKIKC 124
           EQR     F PG+  ++   FN  +  +KLPDG+E  FPNR   + + YLS  GDFK+K 
Sbjct: 68  EQRSGHMCFTPGAEAKISIKFNGDNFEVKLPDGHEITFPNRHGYDKMTYLSVKGDFKVKS 127

Query: 125 VAFE 128
             +E
Sbjct: 128 FKYE 131


>ref|NP_001123680.1| hypothetical protein LOC100170434 [Xenopus (Silurana) tropicalis]
 gb|AAI67136.1| LOC100170434 protein [Xenopus tropicalis]
          Length = 135

 Score =  101 bits (251), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 52/117 (44%), Positives = 71/117 (60%), Gaps = 5/117 (4%)

Query: 7   SNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNL---CNPRFNAHGDVNTIVCNSKDAG 63
           SNL L  G C+ VRG +  +   F +NLG+D  NL   CNPRF+   D +TI+ N+K   
Sbjct: 10  SNLGLHKGHCVEVRGRITKNVNRFAVNLGRDAKNLIMHCNPRFDYSVDKDTIILNAKIND 69

Query: 64  AWGAEQRESAFPFQPGS-VVEVFNQTD-LTIKLPDGYEFKFPNRLNLEAINYLSAGG 118
            WG EQ+E AFPF+ GS  + +F+  D +T+ LPDG E KF  R  ++ +NYL   G
Sbjct: 70  VWGTEQKEPAFPFKAGSETLLIFDFDDCITVHLPDGKEIKFACRFPIDVVNYLDLCG 126


>gb|ACM08322.1| Beta-galactoside-binding lectin [Salmo salar]
 gb|ACM08899.1| Beta-galactoside-binding lectin [Salmo salar]
 gb|ACM09286.1| Beta-galactoside-binding lectin [Salmo salar]
 gb|ACM09664.1| Beta-galactoside-binding lectin [Salmo salar]
          Length = 134

 Score =  101 bits (251), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 50/129 (38%), Positives = 71/129 (55%), Gaps = 6/129 (4%)

Query: 3   GLVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNLC---NPRFNAHGDVNTIVCNS 59
           G+V  N++ K G+ L + G   ++A  F++N+G  +++L    NPRF+AHGD   +VCNS
Sbjct: 3   GVVVKNMSFKLGQTLTITGIPNSEATHFVINVGNSEDDLALHMNPRFDAHGDTRAVVCNS 62

Query: 60  KDAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYLSA 116
              G W  E RE  FPF  G   ++   F +    + LPDG E  FPNR   E   Y+  
Sbjct: 63  YHGGKWCEEHREGGFPFNQGEEFKINITFTKEQFLVSLPDGSEIHFPNRQGDEKYKYMHF 122

Query: 117 GGDFKIKCV 125
            GD +IK V
Sbjct: 123 EGDVRIKGV 131


>ref|NP_956808.1| lectin, galactoside-binding, soluble, 1 (galectin 1)-like 3 [Danio
           rerio]
 gb|AAH55581.1| Lectin, galactoside-binding, soluble, 1 (galectin 1)-like 3 [Danio
           rerio]
 gb|AAI65230.1| Lgals1l3 protein [Danio rerio]
          Length = 119

 Score =  100 bits (249), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 52/115 (45%), Positives = 68/115 (59%), Gaps = 7/115 (6%)

Query: 17  LRVRGEVAADAKSFLLNLGKDDNNLC---NPRFNAHGDVNTIVCNSKDAGAWGAEQRESA 73
           +++ G+V     +F +N+G DD+ +    NPRFNAHGD NTIVCNSK  G WG+E RE  
Sbjct: 3   MKISGKVKPGCDAFSINIGHDDDAIALHFNPRFNAHGDSNTIVCNSKQ-GGWGSEHREHC 61

Query: 74  FPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFKIKCV 125
           FPFQ G   ++   FN     IKLP+G    FPNR   +A  ++   GD KI  V
Sbjct: 62  FPFQQGEEFKLSITFNNETFYIKLPEGTMMSFPNRFGDDAFTHVHVKGDVKIISV 116


>gb|ACM08580.1| Beta-galactoside-binding lectin [Salmo salar]
          Length = 134

 Score =  100 bits (248), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 48/129 (37%), Positives = 71/129 (55%), Gaps = 6/129 (4%)

Query: 3   GLVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNLC---NPRFNAHGDVNTIVCNS 59
           G+V  N++ K G+ L + G   ++A  F++N+G  ++++    NPRF+AHGD   +VCNS
Sbjct: 3   GVVVKNMSFKLGQTLTITGIPNSEATHFVINVGNSEDDIALHMNPRFDAHGDTRAVVCNS 62

Query: 60  KDAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYLSA 116
              G W  E RE  FPF  G   ++   F +    + LPDG E  FPNR   E   Y+  
Sbjct: 63  HHGGKWCEEHREGGFPFNQGEEFKINITFTKEQFLVSLPDGSEIHFPNRQGDEKYKYMHF 122

Query: 117 GGDFKIKCV 125
            GD +I+ V
Sbjct: 123 EGDVRIQGV 131


>ref|XP_001087063.1| PREDICTED: similar to lectin, galactoside-binding, soluble, 2
           [Macaca mulatta]
          Length = 132

 Score = 99.8 bits (247), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 52/120 (43%), Positives = 68/120 (56%), Gaps = 4/120 (3%)

Query: 4   LVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNLCNPRFNAHGDVNTIVCNSKDAG 63
           L   N+++KPG  L++ G +A  A  F++NLG+  + L N  FN     +TIVCNS D  
Sbjct: 5   LEVKNMDMKPGSTLKITGRIADGADGFVINLGQGTDKL-NLHFNPRFSESTIVCNSLDGS 63

Query: 64  AWGAEQRESAFPFQPGSVVE---VFNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDF 120
            WG EQRE    F PGS V+    F      +KLPDG+E  FPNRL    ++YLS  G F
Sbjct: 64  NWGQEQREDHLCFSPGSEVKFTVTFESDKFKVKLPDGHELTFPNRLGHSHLSYLSVRGGF 123


>ref|NP_001134631.1| Beta-galactoside-binding lectin [Salmo salar]
 gb|ACI66975.1| Beta-galactoside-binding lectin [Salmo salar]
 gb|ACI67261.1| Beta-galactoside-binding lectin [Salmo salar]
 gb|ACI68081.1| Beta-galactoside-binding lectin [Salmo salar]
 gb|ACI68276.1| Beta-galactoside-binding lectin [Salmo salar]
 gb|ACM08630.1| Beta-galactoside-binding lectin [Salmo salar]
          Length = 134

 Score = 99.4 bits (246), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 48/129 (37%), Positives = 71/129 (55%), Gaps = 6/129 (4%)

Query: 3   GLVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNLC---NPRFNAHGDVNTIVCNS 59
           G+V  N++ K G+ L + G   ++A  F++N+G  ++++    NPRF+AHGD   +VCNS
Sbjct: 3   GVVVKNMSFKLGQTLTITGIPNSEATHFVINVGNSEDDIALHMNPRFDAHGDTRAVVCNS 62

Query: 60  KDAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYLSA 116
              G W  E RE  FPF  G   ++   F +    + LPDG E  FPNR   E   Y+  
Sbjct: 63  YHGGKWCEEHREGGFPFNQGEEFKINITFTKEQFLVSLPDGSEIHFPNRQGDEKYKYMHF 122

Query: 117 GGDFKIKCV 125
            GD +I+ V
Sbjct: 123 EGDVRIQGV 131


>gb|ACO07656.1| Beta-galactoside-binding lectin [Oncorhynchus mykiss]
 gb|ACO07767.1| Beta-galactoside-binding lectin [Oncorhynchus mykiss]
          Length = 134

 Score = 99.0 bits (245), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 48/129 (37%), Positives = 70/129 (54%), Gaps = 6/129 (4%)

Query: 3   GLVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNLC---NPRFNAHGDVNTIVCNS 59
           G+V  N++ K G+ L + G   ++A  F++N+G  +++L    NPRF+AHGD   +VCNS
Sbjct: 3   GVVVKNMSFKVGQTLTITGIPNSEATHFVINVGNSEDDLALHMNPRFDAHGDTRAVVCNS 62

Query: 60  KDAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYLSA 116
              G W  E RE  FPF  G   ++   F +    +  PDG E  FPNR   E   Y+  
Sbjct: 63  YHGGKWCEEHREGGFPFNQGEKFKINITFTKEQFLVSFPDGSEIHFPNRQGDEKYKYMHF 122

Query: 117 GGDFKIKCV 125
            GD +I+ V
Sbjct: 123 DGDVRIQGV 131


>gb|ACO07452.1| Beta-galactoside-binding lectin [Oncorhynchus mykiss]
 gb|ACO07992.1| Beta-galactoside-binding lectin [Oncorhynchus mykiss]
 gb|ACO08295.1| Beta-galactoside-binding lectin [Oncorhynchus mykiss]
          Length = 134

 Score = 99.0 bits (245), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 48/129 (37%), Positives = 70/129 (54%), Gaps = 6/129 (4%)

Query: 3   GLVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNLC---NPRFNAHGDVNTIVCNS 59
           G+V  N++ K G+ L + G   ++A  F++N+G  +++L    NPRF+AHGD   +VCNS
Sbjct: 3   GVVVKNMSFKVGQTLTITGIPNSEATHFVINVGNSEDDLALHMNPRFDAHGDTRAVVCNS 62

Query: 60  KDAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYLSA 116
              G W  E RE  FPF  G   ++   F +    +  PDG E  FPNR   E   Y+  
Sbjct: 63  YHGGKWCEEHREGGFPFNQGEKFKINITFTKEQFLVSFPDGSEIHFPNRQGDEKYKYMHF 122

Query: 117 GGDFKIKCV 125
            GD +I+ V
Sbjct: 123 EGDVRIQGV 131


>ref|XP_001499566.1| PREDICTED: similar to lectin, galactoside-binding, soluble, 2
           [Equus caballus]
          Length = 154

 Score = 99.0 bits (245), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 50/118 (42%), Positives = 73/118 (61%), Gaps = 4/118 (3%)

Query: 8   NLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGA 67
           N+++K G  L+++G++A DA+ F++NLG+  + L N  FN     +TIVCNS+D  +WG 
Sbjct: 32  NMDMKLGTTLKIKGKIANDAEGFVINLGQGADKL-NLHFNPRFCESTIVCNSRDGDSWGK 90

Query: 68  EQRESAFPFQPGSVVE---VFNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFKI 122
           EQRE+   F PGS V+    F      +KLPDG+   FPNRL    ++YLS  G F +
Sbjct: 91  EQRENHICFSPGSEVKFTVTFESDGFKVKLPDGHLLTFPNRLGHSHLSYLSVQGGFSV 148


>emb|CAF87201.1| unnamed protein product [Tetraodon nigroviridis]
          Length = 135

 Score = 98.6 bits (244), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 50/121 (41%), Positives = 75/121 (61%), Gaps = 6/121 (4%)

Query: 8   NLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNLC---NPRFNAHGDVNTIVCNSKDAGA 64
           N+ L+ G+ L+++G V  DA  F +NLG D+ NL    NPRF+   D + +V NS+ AG+
Sbjct: 9   NVRLRTGDQLKIKGFVLKDADRFRINLGSDEENLALHFNPRFSDTTDESVLVFNSRKAGS 68

Query: 65  WGAEQRESAFPFQPG---SVVEVFNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFK 121
           WG E++ES  P   G    +V         ++LPDG++F FPNR N++ I+Y+  GGDFK
Sbjct: 69  WGEERKESPNPLHRGRDAKIVLKLAGDVFKVELPDGHKFIFPNRENVDVISYIGIGGDFK 128

Query: 122 I 122
           +
Sbjct: 129 L 129


>ref|NP_006489.1| lectin, galactoside-binding, soluble, 2 [Homo sapiens]
 sp|P05162|LEG2_HUMAN RecName: Full=Galectin-2; AltName: Full=Beta-galactoside-binding
           lectin L-14-II; AltName: Full=Lactose-binding lectin 2;
           AltName: Full=S-Lac lectin 2; AltName: Full=HL14
 gb|AAA59512.1| S-lac lectin
 gb|AAA59513.1| S-lac lectin
 emb|CAB42834.1| lectin, galactoside-binding, soluble, 2 [Homo sapiens]
 gb|AAH59782.1| Lectin, galactoside-binding, soluble, 2 [Homo sapiens]
 emb|CAG30398.1| LGALS2 [Homo sapiens]
 emb|CAG46770.1| LGALS2 [Homo sapiens]
 emb|CAG46797.1| LGALS2 [Homo sapiens]
 emb|CAK54542.1| LGALS2 [synthetic construct]
 emb|CAK54841.1| LGALS2 [synthetic construct]
 gb|EAW60167.1| lectin, galactoside-binding, soluble, 2 (galectin 2) [Homo sapiens]
          Length = 132

 Score = 98.6 bits (244), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 51/122 (41%), Positives = 68/122 (55%), Gaps = 4/122 (3%)

Query: 4   LVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNLCNPRFNAHGDVNTIVCNSKDAG 63
           L   N+++KPG  L++ G +A     F++NLG+  + L N  FN     +TIVCNS D  
Sbjct: 5   LEVKNMDMKPGSTLKITGSIADGTDGFVINLGQGTDKL-NLHFNPRFSESTIVCNSLDGS 63

Query: 64  AWGAEQRESAFPFQPGSVVE---VFNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDF 120
            WG EQRE    F PGS V+    F      +KLPDG+E  FPNRL    ++YLS  G F
Sbjct: 64  NWGQEQREDHLCFSPGSEVKFTVTFESDKFKVKLPDGHELTFPNRLGHSHLSYLSVRGGF 123

Query: 121 KI 122
            +
Sbjct: 124 NM 125


>gb|AAX37150.1| lectin galactoside-binding soluble 2 [synthetic construct]
          Length = 133

 Score = 98.6 bits (244), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 51/122 (41%), Positives = 68/122 (55%), Gaps = 4/122 (3%)

Query: 4   LVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNLCNPRFNAHGDVNTIVCNSKDAG 63
           L   N+++KPG  L++ G +A     F++NLG+  + L N  FN     +TIVCNS D  
Sbjct: 5   LEVKNMDMKPGSTLKITGSIADGTDGFVINLGQGTDKL-NLHFNPRFSESTIVCNSLDGS 63

Query: 64  AWGAEQRESAFPFQPGSVVE---VFNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDF 120
            WG EQRE    F PGS V+    F      +KLPDG+E  FPNRL    ++YLS  G F
Sbjct: 64  NWGQEQREDHLCFSPGSEVKFTVTFESDKFKVKLPDGHELTFPNRLGHSHLSYLSVRGGF 123

Query: 121 KI 122
            +
Sbjct: 124 NM 125


>gb|ABW04130.1| galactoside binding lectin [Epinephelus coioides]
          Length = 133

 Score = 98.2 bits (243), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 48/128 (37%), Positives = 73/128 (57%), Gaps = 5/128 (3%)

Query: 3   GLVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNL--CNPRFNAHGDVNTIVCNSK 60
            +V  N++ K G+ + + G V  +A +F +N+G + +     NPRF+AHGD  T+VCNS 
Sbjct: 3   AVVMKNMSFKAGQTMTITGMVNPNATNFAINIGHEQDIALHVNPRFDAHGDQRTVVCNSY 62

Query: 61  DAGAWGAEQRESAFPFQPG---SVVEVFNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAG 117
             G W  E R+S+FPFQ G    V+  FN  +  + LPDG   +FPNRL      ++   
Sbjct: 63  QGGKWCEEVRDSSFPFQLGKEFKVIITFNAQEFQVSLPDGSVVRFPNRLGDTKYRHMKFE 122

Query: 118 GDFKIKCV 125
           GD +I+ +
Sbjct: 123 GDARIQAI 130


>pdb|1HLC|A Chain A, X-Ray Crystal Structure Of The Human Dimeric S-Lac Lectin,
           L-14-Ii, In Complex With Lactose At 2.9 Angstroms
           Resolution
 pdb|1HLC|B Chain B, X-Ray Crystal Structure Of The Human Dimeric S-Lac Lectin,
           L-14-Ii, In Complex With Lactose At 2.9 Angstroms
           Resolution
          Length = 129

 Score = 98.2 bits (243), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 51/122 (41%), Positives = 68/122 (55%), Gaps = 4/122 (3%)

Query: 4   LVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNLCNPRFNAHGDVNTIVCNSKDAG 63
           L   N+++KPG  L++ G +A     F++NLG+  + L N  FN     +TIVCNS D  
Sbjct: 2   LEVKNMDMKPGSTLKITGSIADGTDGFVINLGQGTDKL-NLHFNPRFSESTIVCNSLDGS 60

Query: 64  AWGAEQRESAFPFQPGSVVE---VFNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDF 120
            WG EQRE    F PGS V+    F      +KLPDG+E  FPNRL    ++YLS  G F
Sbjct: 61  NWGQEQREDHLCFSPGSEVKFTVTFESDKFKVKLPDGHELTFPNRLGHSHLSYLSVRGGF 120

Query: 121 KI 122
            +
Sbjct: 121 NM 122


>gb|AAH29063.2| LGALS2 protein [Homo sapiens]
          Length = 130

 Score = 98.2 bits (243), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 51/122 (41%), Positives = 68/122 (55%), Gaps = 4/122 (3%)

Query: 4   LVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNLCNPRFNAHGDVNTIVCNSKDAG 63
           L   N+++KPG  L++ G +A     F++NLG+  + L N  FN     +TIVCNS D  
Sbjct: 3   LEVKNMDMKPGSTLKITGSIADGTDGFVINLGQGTDKL-NLHFNPRFSESTIVCNSLDGS 61

Query: 64  AWGAEQRESAFPFQPGSVVE---VFNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDF 120
            WG EQRE    F PGS V+    F      +KLPDG+E  FPNRL    ++YLS  G F
Sbjct: 62  NWGQEQREDHLCFSPGSEVKFTVTFESDKFKVKLPDGHELTFPNRLGHSHLSYLSVRGGF 121

Query: 121 KI 122
            +
Sbjct: 122 NM 123


>gb|AAA36171.1| beta-galactoside-binding lectin
          Length = 127

 Score = 97.4 bits (241), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 50/118 (42%), Positives = 67/118 (56%), Gaps = 4/118 (3%)

Query: 8   NLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGA 67
           N+++KPG  L++ G +A     F++NLG+  + L N  FN     +TIVCNS D   WG 
Sbjct: 4   NMDMKPGSTLKITGSIADGTDGFVINLGQGTDKL-NLHFNPRFSESTIVCNSLDGSNWGQ 62

Query: 68  EQRESAFPFQPGSVVE---VFNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFKI 122
           EQRE    F PGS V+    F      +KLPDG+E  FPNRL    ++YLS  G F +
Sbjct: 63  EQREDHLCFSPGSEVKFTVTFESDKFKVKLPDGHELTFPNRLGHSHLSYLSIRGGFNM 120


>gb|ABJ80692.1| beta-galactoside-binding lectin [Hippoglossus hippoglossus]
          Length = 134

 Score = 97.4 bits (241), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 48/128 (37%), Positives = 71/128 (55%), Gaps = 6/128 (4%)

Query: 4   LVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNLC---NPRFNAHGDVNTIVCNSK 60
           ++  N++ K G+ L + G    DA +F LN+G  D ++    NPRFNAHGD N +VCNS 
Sbjct: 4   MMVKNMSFKVGQTLTLVGVAKPDATNFALNIGSSDQDIVMHINPRFNAHGDENAVVCNSY 63

Query: 61  DAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAG 117
             G W  E RE  FPFQ G   ++   F   +  + L DG    FPNR+  E  +++S  
Sbjct: 64  IGGQWCEELREGGFPFQLGQEFKITIEFTPQEFLVTLSDGSNIHFPNRIGAEKYSFMSFE 123

Query: 118 GDFKIKCV 125
           G+ +I+ +
Sbjct: 124 GEARIRSI 131


>ref|NP_598283.1| lectin, galactoside-binding, soluble 2 [Rattus norvegicus]
 sp|Q9Z144|LEG2_RAT RecName: Full=Galectin-2
 dbj|BAA74954.1| galectin-2 related protein [Rattus norvegicus]
 gb|EDM15846.1| lectin, galactoside-binding, soluble 2, isoform CRA_a [Rattus
           norvegicus]
          Length = 130

 Score = 97.1 bits (240), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 51/118 (43%), Positives = 69/118 (58%), Gaps = 10/118 (8%)

Query: 7   SNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNL---CNPRFNAHGDVNTIVCNSKDAG 63
           +NLN+K G  L+++G++  D  SF +NLG+    L    NPRFN     +TIVCN+ D  
Sbjct: 8   TNLNMKSGMSLKIKGKIHNDVNSFTINLGQGKETLNLHFNPRFNE----STIVCNTLDGS 63

Query: 64  AWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGG 118
           +WG EQRE+   F PGS V++   F   D  + LPDG+   FPNRL    + YLS  G
Sbjct: 64  SWGQEQRENHSCFSPGSEVKLTLTFQDKDFKVTLPDGHSLTFPNRLGHNHLRYLSMDG 121


>ref|NP_001079042.1| galectin family xgalectin-Vb [Xenopus laevis]
 dbj|BAC55884.1| galectin family xgalectin-Vb [Xenopus laevis]
          Length = 135

 Score = 97.1 bits (240), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 51/114 (44%), Positives = 70/114 (61%), Gaps = 5/114 (4%)

Query: 7   SNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNL---CNPRFNAHGDVNTIVCNSKDAG 63
           +NLNL  G  + VRG ++ D+  F ++LG D NNL   CNPRF    D NTI+ NSK+  
Sbjct: 10  TNLNLHKGHRVEVRGHISKDSSRFAVDLGTDCNNLICHCNPRFEFSEDKNTIIFNSKEND 69

Query: 64  AWGAEQRESAFPFQPGS-VVEVFNQTD-LTIKLPDGYEFKFPNRLNLEAINYLS 115
            WG EQ+E AFPF+ GS  + +F   D + + LPDG +  F  R  ++ INYL+
Sbjct: 70  VWGTEQKEVAFPFKAGSQTMLIFEFGDCINVHLPDGTDIPFACRFPIQVINYLA 123


>gb|ACO08703.1| Beta-galactoside-binding lectin [Oncorhynchus mykiss]
          Length = 134

 Score = 97.1 bits (240), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 48/129 (37%), Positives = 69/129 (53%), Gaps = 6/129 (4%)

Query: 3   GLVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNLC---NPRFNAHGDVNTIVCNS 59
           G+V  N++ K G+ L + G   ++A  F+ N+G  +++L    NPRF+AHGD   +VCNS
Sbjct: 3   GVVVKNVSFKVGQTLTITGIPNSEATHFVTNVGNSEDDLALHMNPRFDAHGDTRAVVCNS 62

Query: 60  KDAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYLSA 116
              G W  E RE  FPF  G   ++   F +    +  PDG E  FPNR   E   Y+  
Sbjct: 63  YHGGKWCEEHREGGFPFNQGEKFKINITFTKEQFLVSFPDGSEIHFPNRQGDEKYKYMHF 122

Query: 117 GGDFKIKCV 125
            GD +I+ V
Sbjct: 123 EGDVRIQGV 131


>gb|AAI69857.1| Galectin family xgalectin-Vb [Xenopus laevis]
 gb|AAI69853.1| Galectin family xgalectin-Vb [Xenopus laevis]
          Length = 135

 Score = 96.7 bits (239), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 51/114 (44%), Positives = 70/114 (61%), Gaps = 5/114 (4%)

Query: 7   SNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNL---CNPRFNAHGDVNTIVCNSKDAG 63
           +NLNL  G  + VRG ++ D+  F ++LG D NNL   CNPRF    D NTI+ NSK+  
Sbjct: 10  TNLNLHKGHRVEVRGHISKDSSRFAVDLGTDCNNLICHCNPRFEFSVDKNTIIFNSKEND 69

Query: 64  AWGAEQRESAFPFQPGS-VVEVFNQTD-LTIKLPDGYEFKFPNRLNLEAINYLS 115
            WG EQ+E AFPF+ GS  + +F   D + + LPDG +  F  R  ++ INYL+
Sbjct: 70  VWGTEQKEVAFPFKAGSQTMLIFEFGDCINVHLPDGTDIPFACRFPIQVINYLA 123


>gb|ACO08799.1| Beta-galactoside-binding lectin [Oncorhynchus mykiss]
          Length = 134

 Score = 96.7 bits (239), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 47/129 (36%), Positives = 70/129 (54%), Gaps = 6/129 (4%)

Query: 3   GLVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNLC---NPRFNAHGDVNTIVCNS 59
           G+V  N++ K G+ L + G   ++A  F++N+G  +++L    NPRF+AHGD   +VC+S
Sbjct: 3   GVVVKNMSSKVGQTLTITGIPNSEATHFVINVGNSEDDLALHMNPRFDAHGDTRAVVCDS 62

Query: 60  KDAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYLSA 116
              G W  E RE  FPF  G   ++   F +    +  PDG E  FPNR   E   Y+  
Sbjct: 63  YHGGKWCEEHREGGFPFNQGEKFKINITFTKEQFLVSFPDGSEIHFPNRQGDEKYKYMHF 122

Query: 117 GGDFKIKCV 125
            GD +I+ V
Sbjct: 123 DGDVRIQGV 131


>ref|XP_525588.2| PREDICTED: lectin, galactoside-binding, soluble, 2 [Pan
           troglodytes]
          Length = 132

 Score = 96.3 bits (238), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 50/122 (40%), Positives = 67/122 (54%), Gaps = 4/122 (3%)

Query: 4   LVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNLCNPRFNAHGDVNTIVCNSKDAG 63
           L   N+++KPG  L++ G +A     F++NLG+  + L N  FN     + IVCNS D  
Sbjct: 5   LEVKNMDMKPGSTLKITGSIADGTDGFVINLGQGTDKL-NLHFNPRFSESIIVCNSLDGS 63

Query: 64  AWGAEQRESAFPFQPGSVVE---VFNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDF 120
            WG EQRE    F PGS V+    F      +KLPDG+E  FPNRL    ++YLS  G F
Sbjct: 64  NWGQEQREDHLCFSPGSEVKFTVTFESDKFKVKLPDGHELTFPNRLGHSHLSYLSIRGGF 123

Query: 121 KI 122
            +
Sbjct: 124 NM 125


>ref|NP_001079245.1| lactose-binding lectin [Xenopus laevis]
 gb|AAA49896.1| lactose-binding lectin
 gb|AAI55892.1| Lactose-binding lectin [Xenopus laevis]
          Length = 135

 Score = 96.3 bits (238), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 52/114 (45%), Positives = 68/114 (59%), Gaps = 5/114 (4%)

Query: 7   SNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNL---CNPRFNAHGDVNTIVCNSKDAG 63
           +NLNL  G  + VRG +A     F ++LG D  NL   CNPRF    D NTIV NSK   
Sbjct: 10  TNLNLHKGHRVEVRGRIAKGTNRFAVDLGTDSRNLICHCNPRFEYSVDKNTIVLNSKQND 69

Query: 64  AWGAEQRESAFPFQPGS-VVEVFNQTD-LTIKLPDGYEFKFPNRLNLEAINYLS 115
            W  E++E+AFPF+ GS  + +F+  D +T+ LPDG E  F  R  +E INYL+
Sbjct: 70  VWDIEKKETAFPFKSGSETMLIFDFEDCITVHLPDGKEIPFTCRFPIEVINYLA 123


>sp|Q29373|LEG2_PIG RecName: Full=Galectin-2
          Length = 123

 Score = 95.1 bits (235), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 48/119 (40%), Positives = 69/119 (57%), Gaps = 10/119 (8%)

Query: 8   NLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNLC---NPRFNAHGDVNTIVCNSKDAGA 64
           N+++K G+ L+++G+   DA  F +NLG+  + L     PRF      +TIVCN +D   
Sbjct: 9   NMDMKVGKTLKIKGKXDDDADGFXINLGQGTDKLALHFXPRFGE----STIVCNXRDGNX 64

Query: 65  WGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDF 120
           WG EQR+S   F PGS V++   F +    +KLPDG++  FPNRL    + YLS  G F
Sbjct: 65  WGKEQRDSHMXFXPGSEVKLIVTFEEDGFKVKLPDGHQLTFPNRLGYSHLRYLSVQGGF 123


>ref|XP_531742.1| PREDICTED: similar to lectin, galactoside-binding, soluble, 2
           isoform 1 [Canis familiaris]
          Length = 130

 Score = 94.4 bits (233), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 49/124 (39%), Positives = 71/124 (57%), Gaps = 5/124 (4%)

Query: 8   NLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGA 67
           N+++K G  L+++G++A DA  F++NLG+  + L N  FN     + IVCNS+D G WG 
Sbjct: 9   NMDMKLGGTLKIKGKIAGDADGFVINLGQGSDKL-NLHFNPRFHESVIVCNSRD-GNWGQ 66

Query: 68  EQRESAFPFQPGSVVE---VFNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFKIKC 124
           EQR+    F PGS V+    F      +KLPDG++  FPNRL    ++YL   G  K+  
Sbjct: 67  EQRDKHMCFSPGSEVKFTVTFENDGFKVKLPDGHQLTFPNRLGHSHLSYLGVQGGLKVSS 126

Query: 125 VAFE 128
              E
Sbjct: 127 FKIE 130


>ref|XP_002196044.1| PREDICTED: similar to lectin galactoside-binding soluble 2 protein
           [Taeniopygia guttata]
          Length = 257

 Score = 93.6 bits (231), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 53/121 (43%), Positives = 68/121 (56%), Gaps = 10/121 (8%)

Query: 8   NLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNLC---NPRFNAHGDVNTIVCNSKDAGA 64
           NLN+KPG  L+V+G++ AD   F +NLG    +L    NPRFN     + IVCNSK +  
Sbjct: 135 NLNMKPGNTLKVKGKIFADTVGFSINLGYSSRDLALHFNPRFNE----SVIVCNSKCSDC 190

Query: 65  WGAEQRESAFPFQPGSVVEVFNQT---DLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFK 121
           W AE R+   PF  G  V+ F +       +KLPDG+E  FPNR     INY+S  G  K
Sbjct: 191 WQAEHRDRHLPFFRGCTVKFFIEMLSDKFRVKLPDGHEVCFPNRHGYHNINYISIVGGLK 250

Query: 122 I 122
           I
Sbjct: 251 I 251


>ref|XP_001510438.1| PREDICTED: similar to beta-galactoside-binding lectin
           [Ornithorhynchus anatinus]
          Length = 130

 Score = 93.2 bits (230), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 49/113 (43%), Positives = 70/113 (61%), Gaps = 10/113 (8%)

Query: 8   NLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNL---CNPRFNAHGDVNTIVCNSKDAGA 64
           NL LK G+ L+++G++A+DA  F+LNLG+  + L    NPRF+       IVCNS+  G 
Sbjct: 8   NLELKSGDTLKIKGKIASDADGFVLNLGRCPDELGLHFNPRFSEAA----IVCNSRSQGH 63

Query: 65  WGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYL 114
           W  E+R++   F PGS V++   F   +  +KLPDG+E  FPNR N + I YL
Sbjct: 64  WEEERRDTHLVFSPGSEVKLTVEFQGDEFRVKLPDGHEVTFPNRNNHDQITYL 116


>ref|XP_861690.1| PREDICTED: similar to lectin, galactoside-binding, soluble, 2
           isoform 2 [Canis familiaris]
          Length = 121

 Score = 92.0 bits (227), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 48/123 (39%), Positives = 70/123 (56%), Gaps = 5/123 (4%)

Query: 9   LNLKPGECLRVRGEVAADAKSFLLNLGKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAE 68
           +++K G  L+++G++A DA  F++NLG+  + L N  FN     + IVCNS+D G WG E
Sbjct: 1   MDMKLGGTLKIKGKIAGDADGFVINLGQGSDKL-NLHFNPRFHESVIVCNSRD-GNWGQE 58

Query: 69  QRESAFPFQPGSVVE---VFNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFKIKCV 125
           QR+    F PGS V+    F      +KLPDG++  FPNRL    ++YL   G  K+   
Sbjct: 59  QRDKHMCFSPGSEVKFTVTFENDGFKVKLPDGHQLTFPNRLGHSHLSYLGVQGGLKVSSF 118

Query: 126 AFE 128
             E
Sbjct: 119 KIE 121


>gb|AAH71424.1| Lgals1l2 protein [Danio rerio]
          Length = 134

 Score = 91.3 bits (225), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 46/129 (35%), Positives = 71/129 (55%), Gaps = 6/129 (4%)

Query: 3   GLVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNLC---NPRFNAHGDVNTIVCNS 59
           G++  N++ K G+ L + G    D+ +F +N+G    ++    NPRF+AHGD  TIVCNS
Sbjct: 3   GVLIQNMSFKVGQTLTITGVPKPDSTNFAINIGHSPEDIALHMNPRFDAHGDQCTIVCNS 62

Query: 60  KDAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYLSA 116
             +G+W  E R++ FPF      ++   F   +  + LPDG E  FPNR   E   Y+  
Sbjct: 63  FQSGSWCEEHRDNNFPFIQDKEFQIKITFTNEEFLVTLPDGSEIHFPNRQGSEKYKYMHF 122

Query: 117 GGDFKIKCV 125
            G+ +I+ V
Sbjct: 123 EGEVRIQGV 131


>gb|EDM15848.1| lectin, galactoside-binding, soluble 2, isoform CRA_c [Rattus
           norvegicus]
          Length = 119

 Score = 90.9 bits (224), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 48/114 (42%), Positives = 65/114 (57%), Gaps = 10/114 (8%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNLGKDDNNL---CNPRFNAHGDVNTIVCNSKDAGAWGA 67
           +K G  L+++G++  D  SF +NLG+    L    NPRFN     +TIVCN+ D  +WG 
Sbjct: 1   MKSGMSLKIKGKIHNDVNSFTINLGQGKETLNLHFNPRFNE----STIVCNTLDGSSWGQ 56

Query: 68  EQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGG 118
           EQRE+   F PGS V++   F   D  + LPDG+   FPNRL    + YLS  G
Sbjct: 57  EQRENHSCFSPGSEVKLTLTFQDKDFKVTLPDGHSLTFPNRLGHNHLRYLSMDG 110


>emb|CAG04110.1| unnamed protein product [Tetraodon nigroviridis]
          Length = 132

 Score = 90.9 bits (224), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 47/127 (37%), Positives = 70/127 (55%), Gaps = 6/127 (4%)

Query: 3   GLVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNLC---NPRFNAHGDVNTIVCNS 59
           GL+  N++ K G+ + + G  + DA +F +N+ +++  +    N RFNAHGD N +VCNS
Sbjct: 5   GLIVKNMSFKVGQTMTIVGVPSPDASNFAINICQNEQEITMHFNARFNAHGDENKVVCNS 64

Query: 60  KDAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYLSA 116
              G W  E RE  FPF+ G   ++   F   +  +KL DG    FPNR+  E    L+ 
Sbjct: 65  YQGGNWCGEVREGGFPFRQGEEFQLTIEFTPAEFLVKLSDGSVIHFPNRVGAEKYALLNF 124

Query: 117 GGDFKIK 123
            GD +IK
Sbjct: 125 DGDVRIK 131


>ref|NP_001068962.1| lectin, galactoside-binding, soluble, 2 [Bos taurus]
 gb|AAI20474.1| Lectin, galactoside-binding, soluble, 3 [Bos taurus]
          Length = 121

 Score = 90.9 bits (224), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 44/109 (40%), Positives = 69/109 (63%), Gaps = 4/109 (3%)

Query: 9   LNLKPGECLRVRGEVAADAKSFLLNLGKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAE 68
           +++K G  L+++G++   A  F++NLG+  + L N  FN     +TIVCNS+D  +WGAE
Sbjct: 1   MDMKMGSSLKIKGKITDGANGFVINLGQGTDKL-NLHFNPRFAESTIVCNSRDGNSWGAE 59

Query: 69  QRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYL 114
           QR++   F PGS V++   F   +  +KLPDG++  FPNRL    ++YL
Sbjct: 60  QRDNHMCFSPGSEVKLIVTFENNEFKVKLPDGHQLTFPNRLGHSHLSYL 108


>ref|NP_998059.1| proto galectin Gal1-L2 [Danio rerio]
 gb|AAR84190.1| proto galectin Gal1-L2 [Danio rerio]
          Length = 134

 Score = 90.9 bits (224), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 46/129 (35%), Positives = 70/129 (54%), Gaps = 6/129 (4%)

Query: 3   GLVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNLC---NPRFNAHGDVNTIVCNS 59
           G++  N++ K G+ L + G    D+ +F +N+G    ++    NPRF+AHGD  TIVCNS
Sbjct: 3   GVLIQNMSFKVGQTLTITGVPKPDSTNFAINIGHSPEDIALHMNPRFDAHGDQCTIVCNS 62

Query: 60  KDAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYLSA 116
             +G+W  E R+  FPF      ++   F   +  + LPDG E  FPNR   E   Y+  
Sbjct: 63  FQSGSWCEEHRDDNFPFIQDKEFQIKITFTNEEFLVTLPDGSEIHFPNRQGSEKYKYMYF 122

Query: 117 GGDFKIKCV 125
            G+ +I+ V
Sbjct: 123 EGEVRIQGV 131


>ref|XP_001376599.1| PREDICTED: similar to Galectin-1 (Lectin galactoside-binding
           soluble 1) (Beta-galactoside-binding lectin L-14-I)
           (Lactose-binding lectin 1) (S-Lac lectin 1) (Galaptin)
           (14 kDa lectin) (RL 14.5) [Monodelphis domestica]
          Length = 227

 Score = 90.5 bits (223), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 44/106 (41%), Positives = 66/106 (62%), Gaps = 6/106 (5%)

Query: 29  SFLLNLGKDDNNL---CNPRFNAHGDVNTIVCNSKDAGAWGAEQRESAFPFQPGSVVEV- 84
           +F++N  +D + +    NPRFN   D N IVCN K    WG EQ+++ FPF+PG+  +V 
Sbjct: 122 NFVINCAQDHDTIGFHFNPRFNRFRDKNIIVCNFKKDDGWGNEQKDTNFPFKPGTQTKVC 181

Query: 85  --FNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFKIKCVAFE 128
             F +T   + LP+G E +FPN LNL+ IN L    DF+++ +AF+
Sbjct: 182 IDFEKTAFHVTLPNGCEIQFPNHLNLDTINLLEVKADFELRSLAFK 227



 Score = 55.8 bits (133), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 27/59 (45%), Positives = 34/59 (57%), Gaps = 3/59 (5%)

Query: 29 SFLLNLGKDDNNL---CNPRFNAHGDVNTIVCNSKDAGAWGAEQRESAFPFQPGSVVEV 84
          SF + L +D  N     NPRF    D   I CNSK    WG EQ+E+ FPF+PG++ EV
Sbjct: 11 SFAITLAEDHENFGLHFNPRFKIGNDNKIIACNSKYDDVWGEEQKEANFPFEPGTLTEV 69


>gb|ACO51808.1| Galectin-1 [Rana catesbeiana]
          Length = 128

 Score = 90.1 bits (222), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 46/111 (41%), Positives = 65/111 (58%), Gaps = 6/111 (5%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNLGKDDNNLC---NPRFNAHGDVNTIVCNSKDAGAWGA 67
           ++PG  + V G +    + F++N+GKD +NL     PRF+  GD   IV NS + G WGA
Sbjct: 6   IRPGFRVDVEGFIPHGCQYFVINMGKDPSNLVIHFEPRFDYRGDKGKIVLNSGNGGTWGA 65

Query: 68  EQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYLS 115
           EQ+E  FPFQ GS  ++   F Q  +T++LP G  F FP R  +  I +LS
Sbjct: 66  EQKEGYFPFQTGSSTKISFTFEQDKITVRLPTGNPFLFPIRFPITDITFLS 116


>sp|P08520|LEG_ELEEL RecName: Full=Beta-galactoside-binding lectin; AltName: Full=14 kDa
           lectin; AltName: Full=Electrolectin
          Length = 129

 Score = 88.6 bits (218), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 45/108 (41%), Positives = 62/108 (57%), Gaps = 6/108 (5%)

Query: 3   GLVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNLC---NPRFNAHGDVNTIVCNS 59
           G+V   ++ K G+ L V+G  + D+ +F +N+G    +L    NPRF+AHGD   +V NS
Sbjct: 4   GVVDERMSFKAGQNLTVKGVPSIDSTNFAINVGNSAEDLALHINPRFDAHGDQQAVVVNS 63

Query: 60  KDAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPN 104
              G WG EQRE  FPF+ G   ++   FN  +  I LPDG E  FPN
Sbjct: 64  FQGGNWGTEQREGGFPFKQGEDFKIQITFNSEEFRIILPDGSEIHFPN 111


>gb|AAF61069.1|AF220550_1 galectin [Paralichthys olivaceus]
          Length = 135

 Score = 87.0 bits (214), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 46/120 (38%), Positives = 65/120 (54%), Gaps = 6/120 (5%)

Query: 10  NLKPGECLRVRGEVAADAKSFLLNLGKDDNNLC---NPRFNAHGDVNTIVCNSKDAGAWG 66
           + K G+ + + G    DA +F LN+G  D ++    NPRFNAHGD N +VCNS     W 
Sbjct: 11  SFKVGQTMTIIGVPKPDATNFALNIGPTDQDIVMHINPRFNAHGDENAVVCNSYIGRQWC 70

Query: 67  AEQRESAFPFQPGS---VVEVFNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFKIK 123
            E RE  FPFQ G    +V  F   +  + L DG    FPNR+  E  +++S  G+ +I+
Sbjct: 71  EELREGGFPFQLGEEFKIVIEFTPQEFLVTLSDGSIIHFPNRIGAEKYSFMSFEGEARIR 130


>gb|ACI69049.1| Galectin-2 [Salmo salar]
          Length = 129

 Score = 82.4 bits (202), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 48/120 (40%), Positives = 64/120 (53%), Gaps = 10/120 (8%)

Query: 9   LNLKPGECLRVRGEVAADAKSFLLNLGKDDNNLC---NPRFNAHGDVNTIVCNSKDAGAW 65
           ++ K G+ +   G+  + A SF +N+G D +N     NPRF  HG    IVCNS   G+W
Sbjct: 8   MSFKQGQEMTFTGKTKSGASSFSINIGHDSDNYALHFNPRFT-HGQ---IVCNSLSGGSW 63

Query: 66  GAEQRESAFPFQPGS---VVEVFNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFKI 122
           G E +E  FPFQ G    +V  F      IKLPDG+   FPNRL     N++   GD K+
Sbjct: 64  GDEFKEGHFPFQDGEQFKLVLNFTNEQFYIKLPDGHMMDFPNRLGDCKYNHIMVDGDVKV 123


>ref|XP_001376472.1| PREDICTED: similar to S-lac lectin [Monodelphis domestica]
          Length = 142

 Score = 82.0 bits (201), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 42/117 (35%), Positives = 66/117 (56%), Gaps = 10/117 (8%)

Query: 8   NLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNL---CNPRFNAHGDVNTIVCNSKDAGA 64
           +++LK G  L+++G++  DA  F++NLG+   NL    NPRF       TIVCNS++ G 
Sbjct: 20  HMDLKQGMTLKLKGKINDDANGFVINLGQSPGNLDLHFNPRFGE----KTIVCNSQNGGR 75

Query: 65  WGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGG 118
           W  E R+    F PG+ +++     + +  +KLPDG++ KFPNR     + Y    G
Sbjct: 76  WEQEHRDDHVCFSPGTEIKLTVTLEEDEFQVKLPDGHQVKFPNRRKCSHLPYCCVEG 132


>gb|ACI68076.1| Galectin-2 [Salmo salar]
 gb|ACN09900.1| Galectin-2 [Salmo salar]
 gb|ACN12247.1| Galectin-2 [Salmo salar]
          Length = 129

 Score = 80.9 bits (198), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 46/120 (38%), Positives = 63/120 (52%), Gaps = 10/120 (8%)

Query: 9   LNLKPGECLRVRGEVAADAKSFLLNLGKDDNNLC---NPRFNAHGDVNTIVCNSKDAGAW 65
           ++ K G+ +   G+  + A SF +N+G D +N     NPRF+       IVCNS   G+W
Sbjct: 8   MSFKQGQEMTFTGKTKSGASSFSINIGHDSDNYALHFNPRFSHE----HIVCNSLSGGSW 63

Query: 66  GAEQRESAFPFQPGS---VVEVFNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFKI 122
           G E +E  FPFQ G    +V  F      IKLPDG+   FPNRL     N++   GD K+
Sbjct: 64  GDELKEGHFPFQDGEQFKLVLNFTNEQFYIKLPDGHMMDFPNRLGDCKYNHIMVDGDVKV 123


>gb|ACN10131.1| Galectin-2 [Salmo salar]
 gb|ACN12482.1| Galectin-2 [Salmo salar]
          Length = 129

 Score = 80.5 bits (197), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 46/120 (38%), Positives = 63/120 (52%), Gaps = 10/120 (8%)

Query: 9   LNLKPGECLRVRGEVAADAKSFLLNLGKDDNNLC---NPRFNAHGDVNTIVCNSKDAGAW 65
           ++ K G+ +   G+  + A SF +N+G D +N     NPRF+       IVCNS   G+W
Sbjct: 8   MSFKQGQEMPFTGKTKSGASSFSINIGHDSDNYALHFNPRFSHE----HIVCNSLSGGSW 63

Query: 66  GAEQRESAFPFQPGS---VVEVFNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFKI 122
           G E +E  FPFQ G    +V  F      IKLPDG+   FPNRL     N++   GD K+
Sbjct: 64  GDELKEGHFPFQDGEQFKLVLNFTNEQFYIKLPDGHMMDFPNRLGDCKYNHIMVDGDVKV 123


>ref|NP_001005958.1| lectin, galactoside-binding, soluble, 1 (galectin 1)-like 1 [Danio
           rerio]
 gb|AAH83310.1| Lectin, galactoside-binding, soluble, 1 (galectin 1)-like 1 [Danio
           rerio]
 gb|AAI64225.1| Lgals1l1 protein [Danio rerio]
          Length = 134

 Score = 79.3 bits (194), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 41/128 (32%), Positives = 64/128 (50%), Gaps = 6/128 (4%)

Query: 4   LVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNLC---NPRFNAHGDVNTIVCNSK 60
           ++  N+  K G+ L + G   +++  F +N+G    ++    NPRF+AHGD   IVCN+ 
Sbjct: 4   VLIQNMAFKAGQTLTLTGVPKSESSEFKINIGNSSEDIALHINPRFDAHGDQCIIVCNTF 63

Query: 61  DAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAG 117
               W  E RE+ FPF  G   ++   F   +  + LPD  E  FPNR   E   Y+   
Sbjct: 64  QNDCWCEEHRETNFPFVQGEEFQIKITFTNEEFLVTLPDDSEIHFPNRQGSEKYKYMHFE 123

Query: 118 GDFKIKCV 125
           G  +I+ +
Sbjct: 124 GQARIQGI 131


>gb|AAB60464.1| beta-galactoside-binding lectin
          Length = 40

 Score = 78.2 bits (191), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 35/40 (87%), Positives = 39/40 (97%)

Query: 89  DLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFKIKCVAFE 128
           DLTIKLPDG+EFKFPNRLN+EAINY++A GDFKIKCVAFE
Sbjct: 1   DLTIKLPDGHEFKFPNRLNMEAINYMAADGDFKIKCVAFE 40


>ref|XP_001330970.1| PREDICTED: hypothetical protein [Danio rerio]
          Length = 134

 Score = 77.4 bits (189), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 40/128 (31%), Positives = 64/128 (50%), Gaps = 6/128 (4%)

Query: 4   LVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNLC---NPRFNAHGDVNTIVCNSK 60
           ++  N+  K G+ L + G    ++  F +++G    ++    NPRF+AHGD   IVCN+ 
Sbjct: 4   VLIQNMAFKVGQTLTLTGVPKPESPEFTIDIGNSSEDIALHINPRFDAHGDQCIIVCNTF 63

Query: 61  DAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAG 117
               W  E R+  FPF  G   ++   F   +  + LPDG E  FPNR   E   Y++  
Sbjct: 64  QNDCWCEEHRDENFPFVQGEEFQIKITFTNEEFLVTLPDGSEINFPNRQGSEKYKYMNFT 123

Query: 118 GDFKIKCV 125
           G  +I+ +
Sbjct: 124 GQARIQGI 131


>gb|ACM08436.1| Beta-galactoside-binding lectin [Salmo salar]
          Length = 96

 Score = 72.0 bits (175), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 34/87 (39%), Positives = 50/87 (57%), Gaps = 3/87 (3%)

Query: 3  GLVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNLC---NPRFNAHGDVNTIVCNS 59
          G+V  N++ K G+ L +     ++A  F++N+G  +++L    NPRF+AHGD   +VCNS
Sbjct: 3  GVVVKNMSFKLGQTLTITWIPNSEATHFVINVGNSEDDLALHMNPRFDAHGDTRAVVCNS 62

Query: 60 KDAGAWGAEQRESAFPFQPGSVVEVFN 86
             G W  E RE  FPF  G   +V N
Sbjct: 63 YHGGKWCEEHREGGFPFNQGEEFKVRN 89


>ref|XP_001083444.1| PREDICTED: lectin, galactoside-binding, soluble, 7 (galectin 7)
           [Macaca mulatta]
          Length = 136

 Score = 67.8 bits (164), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 42/125 (33%), Positives = 63/125 (50%), Gaps = 15/125 (12%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAE 68
           ++PG  LR+RG V  +A  F +NL  G++ ++     FN   D + +V NSK+ G+WG E
Sbjct: 14  IRPGTVLRIRGLVPPNASRFHINLLCGEEQDSDAALHFNPRLDTSEVVFNSKEQGSWGRE 73

Query: 69  QRESAFPFQPGSVVEVFNQTDLTIKLPDGYE--------FKFPNRLNLEAINYLSAGGDF 120
           +R    PFQ G   EV     L I   DG++          F +RL L  +  +  GGD 
Sbjct: 74  ERGPGVPFQRGQPFEV-----LIIASDDGFKAVVGDAQYHHFRHRLPLARVRLVEVGGDV 128

Query: 121 KIKCV 125
           ++  V
Sbjct: 129 QLDSV 133


>gb|AAH42911.2| LGALS7B protein [Homo sapiens]
          Length = 133

 Score = 67.0 bits (162), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 42/125 (33%), Positives = 62/125 (49%), Gaps = 15/125 (12%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAE 68
           ++PG  LR+RG V  +A  F +NL  G++  +     FN   D + +V NSK+ G+WG E
Sbjct: 11  IRPGTVLRIRGLVPPNASRFHVNLLCGEEQGSDAALHFNPRLDTSEVVFNSKEQGSWGRE 70

Query: 69  QRESAFPFQPGSVVEVFNQTDLTIKLPDGYE--------FKFPNRLNLEAINYLSAGGDF 120
           +R    PFQ G   EV     L I   DG++          F +RL L  +  +  GGD 
Sbjct: 71  ERGPGVPFQRGQPFEV-----LIIASDDGFKAVVGDAQYHHFRHRLPLARVRLVEVGGDV 125

Query: 121 KIKCV 125
           ++  V
Sbjct: 126 QLDSV 130


>ref|NP_002298.1| galectin-7 [Homo sapiens]
 ref|NP_001035972.1| galectin-7B [Homo sapiens]
 ref|XP_001721023.1| PREDICTED: similar to galectin-7 [Homo sapiens]
 sp|P47929|LEG7_HUMAN RecName: Full=Galectin-7; Short=Gal-7; AltName: Full=HKL-14;
           AltName: Full=PI7; AltName: Full=p53-induced gene 1
           protein
 gb|AAA67899.1| galectin-7
 gb|AAA86820.1| keratinocyte lectin 14
 gb|AAH61588.1| Lectin, galactoside-binding, soluble, 7B [Homo sapiens]
 emb|CAG33198.1| LGALS7 [Homo sapiens]
 gb|AAH73743.1| Lectin, galactoside-binding, soluble, 7B [Homo sapiens]
 gb|EAW56817.1| hCG1776519 [Homo sapiens]
 gb|EAW56818.1| hCG42850 [Homo sapiens]
          Length = 136

 Score = 66.6 bits (161), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 42/125 (33%), Positives = 62/125 (49%), Gaps = 15/125 (12%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAE 68
           ++PG  LR+RG V  +A  F +NL  G++  +     FN   D + +V NSK+ G+WG E
Sbjct: 14  IRPGTVLRIRGLVPPNASRFHVNLLCGEEQGSDAALHFNPRLDTSEVVFNSKEQGSWGRE 73

Query: 69  QRESAFPFQPGSVVEVFNQTDLTIKLPDGYE--------FKFPNRLNLEAINYLSAGGDF 120
           +R    PFQ G   EV     L I   DG++          F +RL L  +  +  GGD 
Sbjct: 74  ERGPGVPFQRGQPFEV-----LIIASDDGFKAVVGDAQYHHFRHRLPLARVRLVEVGGDV 128

Query: 121 KIKCV 125
           ++  V
Sbjct: 129 QLDSV 133


>pdb|3GAL|A Chain A, Crystal Structure Of Human Galectin-7 In Complex With
           Galactosamine
 pdb|3GAL|B Chain B, Crystal Structure Of Human Galectin-7 In Complex With
           Galactosamine
 pdb|4GAL|A Chain A, Crystal Structure Of Human Galectin-7 In Complex With
           Lactose
 pdb|4GAL|B Chain B, Crystal Structure Of Human Galectin-7 In Complex With
           Lactose
 pdb|5GAL|A Chain A, Crystal Structure Of Human Galectin-7 In Complex With N-
           Acetyllactosamine
 pdb|5GAL|B Chain B, Crystal Structure Of Human Galectin-7 In Complex With N-
           Acetyllactosamine
 pdb|2GAL|A Chain A, Crystal Structure Of Human Galectin-7 In Complex With
           Galactose
 pdb|2GAL|B Chain B, Crystal Structure Of Human Galectin-7 In Complex With
           Galactose
 pdb|1BKZ|A Chain A, Crystal Structure Of Human Galectin-7
 pdb|1BKZ|B Chain B, Crystal Structure Of Human Galectin-7
          Length = 135

 Score = 66.6 bits (161), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 42/125 (33%), Positives = 62/125 (49%), Gaps = 15/125 (12%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAE 68
           ++PG  LR+RG V  +A  F +NL  G++  +     FN   D + +V NSK+ G+WG E
Sbjct: 13  IRPGTVLRIRGLVPPNASRFHVNLLCGEEQGSDAALHFNPRLDTSEVVFNSKEQGSWGRE 72

Query: 69  QRESAFPFQPGSVVEVFNQTDLTIKLPDGYE--------FKFPNRLNLEAINYLSAGGDF 120
           +R    PFQ G   EV     L I   DG++          F +RL L  +  +  GGD 
Sbjct: 73  ERGPGVPFQRGQPFEV-----LIIASDDGFKAVVGDAQYHHFRHRLPLARVRLVEVGGDV 127

Query: 121 KIKCV 125
           ++  V
Sbjct: 128 QLDSV 132


>dbj|BAA36385.1| Conger eel galectin (Congerin I) [Conger myriaster]
          Length = 137

 Score = 65.9 bits (159), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 45/134 (33%), Positives = 64/134 (47%), Gaps = 8/134 (5%)

Query: 3   GLVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNLC---NPRFNAHGDVNTIVCNS 59
           GL   N +   G+ L V G +    + F +N+G+  N+L    + RFN   D NTIV NS
Sbjct: 4   GLQVKNFDFTVGKFLTVGGFINNSPQRFSVNVGESMNSLSLHLDHRFNYGADQNTIVMNS 63

Query: 60  --KDAGAWGAEQRESAFPFQPGSVVEVFNQTDLT---IKLPDGYEFKFPNRLNLEAINYL 114
             K    W  EQR + F    G   E+    D+    I + DG   +FPNR + E + +L
Sbjct: 64  TLKGDNGWETEQRSTNFTLSAGQYFEITLSYDINKFYIDILDGPNLEFPNRYSKEFLPFL 123

Query: 115 SAGGDFKIKCVAFE 128
           S  GD ++  V  E
Sbjct: 124 SLAGDARLTLVKLE 137


>pdb|1C1F|A Chain A, Ligand-Free Congerin I
 pdb|1C1L|A Chain A, Lactose-Liganded Congerin I
          Length = 136

 Score = 65.5 bits (158), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 45/134 (33%), Positives = 64/134 (47%), Gaps = 8/134 (5%)

Query: 3   GLVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNLC---NPRFNAHGDVNTIVCNS 59
           GL   N +   G+ L V G +    + F +N+G+  N+L    + RFN   D NTIV NS
Sbjct: 3   GLQVKNFDFTVGKFLTVGGFINNSPQRFSVNVGESMNSLSLHLDHRFNYGADQNTIVMNS 62

Query: 60  --KDAGAWGAEQRESAFPFQPGSVVEVFNQTDLT---IKLPDGYEFKFPNRLNLEAINYL 114
             K    W  EQR + F    G   E+    D+    I + DG   +FPNR + E + +L
Sbjct: 63  TLKGDNGWETEQRSTNFTLSAGQYFEITLSYDINKFYIDILDGPNLEFPNRYSKEFLPFL 122

Query: 115 SAGGDFKIKCVAFE 128
           S  GD ++  V  E
Sbjct: 123 SLAGDARLTLVKLE 136


>ref|XP_001367884.1| PREDICTED: similar to galectin-7 [Monodelphis domestica]
          Length = 138

 Score = 65.1 bits (157), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 43/125 (34%), Positives = 61/125 (48%), Gaps = 13/125 (10%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL------GKDDNNLCNPRFNAHGDVNTIVCNSKDAGA 64
           L+PG  +RVRG V  +A  F +NL      G D    CNPR     D   +V N+ + GA
Sbjct: 16  LRPGSVIRVRGTVPDNASRFHVNLLCSEGSGADTALHCNPRL----DTGEMVFNTFEKGA 71

Query: 65  WGAEQRESAFPFQPGSVVE-VFNQTDLTIKLPDGYEF--KFPNRLNLEAINYLSAGGDFK 121
           WG E+R    PFQ G   + +    D + K   G     +F +R+ L  +  L  GGD +
Sbjct: 72  WGQEERSPHLPFQRGQPFDLLLIAGDDSFKAVTGDHMFHRFSHRMPLGLVRVLEVGGDVQ 131

Query: 122 IKCVA 126
           ++ VA
Sbjct: 132 LQNVA 136


>sp|Q801X7|AJL1_ANGJA RecName: Full=Galactose-binding lectin l-1; Short=Galectin;
           AltName: Full=Ajl-1
 dbj|BAC67210.1| galectin [Anguilla japonica]
          Length = 142

 Score = 63.9 bits (154), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 40/125 (32%), Positives = 59/125 (47%), Gaps = 6/125 (4%)

Query: 8   NLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNLC---NPRFNAHGDVNTIVCNSKDAGA 64
           NL +K G  L+V G   A+ + F +N+G     +    + RF+   D   ++ N K   A
Sbjct: 8   NLIMKSGMELKVNGVFNANPERFSINVGHSTEEIAVHVDVRFSYLSDKRQLIINHKTGDA 67

Query: 65  WGAEQRESAFPFQPGSVVE---VFNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFK 121
           W  EQR++ FPF  G   +   VFN     I LPDG    F N L  +   Y+   GD  
Sbjct: 68  WQEEQRDARFPFTAGQAFQVSVVFNFDTFDIYLPDGQVAHFTNHLGAQEYKYIFFVGDAT 127

Query: 122 IKCVA 126
           +K ++
Sbjct: 128 VKNIS 132


>sp|P26788|LEG1_CONMY RecName: Full=Congerin-1; AltName: Full=Congerin I; AltName:
           Full=Beta-galactoside-binding lectin 1
          Length = 135

 Score = 63.5 bits (153), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 44/131 (33%), Positives = 63/131 (48%), Gaps = 8/131 (6%)

Query: 3   GLVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNLC---NPRFNAHGDVNTIVCNS 59
           GL   N +   G+ L V G +    + F +N+G+  N+L    + RFN   D NTIV NS
Sbjct: 3   GLQVKNFDFTVGKFLTVGGFINNSPQRFSVNVGESMNSLSLHLDHRFNYGADQNTIVMNS 62

Query: 60  --KDAGAWGAEQRESAFPFQPGSVVEVFNQTDLT---IKLPDGYEFKFPNRLNLEAINYL 114
             K    W  EQR + F    G   E+    D+    I + DG   +FPNR + E + +L
Sbjct: 63  TLKGDNGWETEQRSTNFTLSAGQYFEITLSYDINKFYIDILDGPNLEFPNRYSKEFLPFL 122

Query: 115 SAGGDFKIKCV 125
           S  GD ++  V
Sbjct: 123 SLAGDARLTLV 133


>gb|ACC54752.1| galactose-binding lectin soluble 1 [Xenopus borealis]
          Length = 72

 Score = 59.7 bits (143), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 28/63 (44%), Positives = 37/63 (58%), Gaps = 3/63 (4%)

Query: 59  SKDAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYLS 115
           SK+   WG EQRE+ FPFQ G+   +   +    L +KL DG EF FP R+ L+ I +LS
Sbjct: 1   SKEENRWGTEQRENVFPFQQGAETLICFEYQADHLKVKLSDGQEFNFPIRMPLDTITFLS 60

Query: 116 AGG 118
             G
Sbjct: 61  MDG 63


>gb|AAB40658.1| galectin-7 [Rattus norvegicus]
          Length = 136

 Score = 58.9 bits (141), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 35/120 (29%), Positives = 55/120 (45%), Gaps = 5/120 (4%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAE 68
           ++ G  +R+RG V   A  F +NL  G++    C   FN   D + +V N+K  G WG E
Sbjct: 14  VRLGTVMRIRGVVPDQAGRFHVNLLCGEEQEADCALHFNPRLDTSEVVFNTKQQGKWGRE 73

Query: 69  QRESAFPFQPGSVVEVF---NQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFKIKCV 125
           +R +  PFQ G   EV     +      + D     F +R+    +  +  GGD ++  V
Sbjct: 74  ERGTGIPFQRGQPFEVLIITTEEGFKTVIGDDEYLHFHHRMPSSNVRSVEVGGDVQLHSV 133


>ref|XP_001234400.1| PREDICTED: similar to galectin-2 related protein isoform 1
          [Gallus gallus]
          Length = 94

 Score = 58.5 bits (140), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 32/79 (40%), Positives = 47/79 (59%), Gaps = 7/79 (8%)

Query: 8  NLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNLC---NPRFNAHGDVNTIVCNSKDAGA 64
          NL+ K G  ++++G ++ DA+SF +NLG   ++L    NPRFN     + IVCNS  +  
Sbjct: 9  NLDWKSGGTMKIKGHISEDAESFAINLGCKSSDLALHFNPRFNE----SVIVCNSLCSDN 64

Query: 65 WGAEQRESAFPFQPGSVVE 83
          W  EQR+  F F  GS V+
Sbjct: 65 WQQEQRDKHFNFYKGSTVK 83


>sp|P47953|LEG3_CRILO RecName: Full=Galectin-3; AltName: Full=Galactose-specific lectin
           3; AltName: Full=Mac-2 antigen; AltName:
           Full=IgE-binding protein; AltName: Full=35 kDa lectin;
           AltName: Full=Carbohydrate-binding protein 35; Short=CBP
           35; AltName: Full=Laminin-binding protein; AltName:
           Full=Lectin L-29; AltName: Full=CBP30
 pir||A54909 carbohydrate-binding protein CBP30 - hamster
 emb|CAA55479.1| galectin 3 [Cricetulus longicaudatus]
          Length = 245

 Score = 58.5 bits (140), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 39/120 (32%), Positives = 61/120 (50%), Gaps = 7/120 (5%)

Query: 13  PGECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAEQR 70
           P   + + G V  +A   +LN   G D     NPRFN + +   IVCN+K    WG E+R
Sbjct: 123 PRMLITIMGTVKPNANRIILNFLRGNDIAFHFNPRFNEN-NRRVIVCNTKQDNNWGREER 181

Query: 71  ESAFPFQPGS--VVEVFNQTD-LTIKLPDGYEFKFPNRL-NLEAINYLSAGGDFKIKCVA 126
           +SAFPF+ G    ++V  + D   + + D +  ++ +R+ NL  IN +   GD  +   A
Sbjct: 182 QSAFPFESGRPFKIQVLVEADHFKVAVNDAHLLQYNHRMKNLREINQMEISGDITLTSAA 241


>ref|XP_422899.2| PREDICTED: similar to galectin-2 related protein isoform 5
          [Gallus gallus]
 ref|XP_001234420.1| PREDICTED: similar to galectin-2 related protein isoform 2
          [Gallus gallus]
 ref|XP_001234431.1| PREDICTED: similar to galectin-2 related protein isoform 3
          [Gallus gallus]
 ref|XP_001234439.1| PREDICTED: similar to galectin-2 related protein isoform 4
          [Gallus gallus]
          Length = 88

 Score = 58.2 bits (139), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 32/79 (40%), Positives = 47/79 (59%), Gaps = 7/79 (8%)

Query: 8  NLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNLC---NPRFNAHGDVNTIVCNSKDAGA 64
          NL+ K G  ++++G ++ DA+SF +NLG   ++L    NPRFN     + IVCNS  +  
Sbjct: 3  NLDWKSGGTMKIKGHISEDAESFAINLGCKSSDLALHFNPRFNE----SVIVCNSLCSDN 58

Query: 65 WGAEQRESAFPFQPGSVVE 83
          W  EQR+  F F  GS V+
Sbjct: 59 WQQEQRDKHFNFYKGSTVK 77


>pdb|1WLC|A Chain A, Congerin Ii Y16sT88I DOUBLE MUTANT
          Length = 135

 Score = 58.2 bits (139), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 40/129 (31%), Positives = 63/129 (48%), Gaps = 9/129 (6%)

Query: 8   NLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNLC---NPRFNAHGDVNTIVCNS--KDA 62
           N+  K G  L V G V ++A  F +N+G+  +++    + RF+   D N +V NS   + 
Sbjct: 8   NIPFKLGMSLTVGGVVNSNATRFSINVGESTDSIAMHMDHRFSYGADQNVLVLNSLVHNV 67

Query: 63  GAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGD 119
           G W  E+R   FPF  G   ++   F+     I+L +G   +FPNR    A N +   GD
Sbjct: 68  G-WQQEERSKKFPFTKGDHFQITITFDTHTFYIQLSNGETVEFPNRNKDAAFNLIYLAGD 126

Query: 120 FKIKCVAFE 128
            ++  V  E
Sbjct: 127 ARLTFVRLE 135


>ref|XP_001255073.1| PREDICTED: similar to lectin, galactose binding, soluble 7 [Bos
           taurus]
          Length = 139

 Score = 57.8 bits (138), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 37/120 (30%), Positives = 58/120 (48%), Gaps = 5/120 (4%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAE 68
           ++ G  LR+RG V   A  F +NL  G++  +     FN   D +T+V N+ + G WGAE
Sbjct: 17  IRVGTVLRIRGLVPDKAGRFYVNLLCGEEPGSDAALHFNPRLDESTVVFNTLERGTWGAE 76

Query: 69  QRESAFPF---QPGSVVEVFNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFKIKCV 125
           +R S  PF   QP  V+ +  +      + D     F  R+    +  L  GGD +++ V
Sbjct: 77  ERGSGIPFQRGQPFDVLLIATEEGFKAVIADSEYHHFRYRIPPGRVRALEVGGDLQLELV 136


>ref|XP_001495783.2| PREDICTED: similar to lectin, galactose binding, soluble 3 [Equus
           caballus]
          Length = 266

 Score = 57.8 bits (138), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 38/118 (32%), Positives = 60/118 (50%), Gaps = 7/118 (5%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAE 68
           + P   + + G V  +   F LN   G D     NPRFN + +   IVCN+K    WG E
Sbjct: 142 VTPRMLITILGTVKPNPNRFALNFNRGHDVAFHFNPRFNEN-NRRVIVCNTKQDNVWGRE 200

Query: 69  QRESAFPFQPGS--VVEVFNQTD-LTIKLPDGYEFKFPNRL-NLEAINYLSAGGDFKI 122
           +R++ FPF+ G    ++V  + D   + + D +  ++ +R+ NL  IN LS  GD  +
Sbjct: 201 ERQAVFPFESGKPFKIQVLVEADHFKVAVNDAHLLQYNHRMRNLREINTLSISGDINL 258


>pdb|1WLD|A Chain A, Congerin Ii T88i Single Mutant
          Length = 135

 Score = 57.8 bits (138), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 40/129 (31%), Positives = 63/129 (48%), Gaps = 9/129 (6%)

Query: 8   NLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNLC---NPRFNAHGDVNTIVCNS--KDA 62
           N+  K G  L V G V ++A  F +N+G+  +++    + RF+   D N +V NS   + 
Sbjct: 8   NIPFKLGMYLTVGGVVNSNATRFSINVGESTDSIAMHMDHRFSYGADQNVLVLNSLVHNV 67

Query: 63  GAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGD 119
           G W  E+R   FPF  G   ++   F+     I+L +G   +FPNR    A N +   GD
Sbjct: 68  G-WQQEERSKKFPFTKGDHFQITITFDTHTFYIQLSNGETVEFPNRNKDAAFNLIYLAGD 126

Query: 120 FKIKCVAFE 128
            ++  V  E
Sbjct: 127 ARLTFVRLE 135


>ref|XP_001915598.1| PREDICTED: similar to galectin 9, partial [Equus caballus]
          Length = 267

 Score = 57.8 bits (138), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 36/127 (28%), Positives = 65/127 (51%), Gaps = 12/127 (9%)

Query: 11  LKPGECLRVRGEV-AADAKSFLLNL--GKDDNNLC---NPRFNAHGDVNTIVCNSKDAGA 64
           L+ G  + VRG V  +    F +N   G+ D+++    NPRF   G   ++VCN+K  G 
Sbjct: 12  LQEGLEITVRGTVLPSSGTRFAVNFQTGRSDDDIAFHFNPRFEEGG---SVVCNTKKKGL 68

Query: 65  WGAEQRESAFPFQPGSVVE---VFNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFK 121
           WG E++++  PFQ GS  E   +   +   + L      ++P+R+    ++ LS  G  +
Sbjct: 69  WGLEEKKTHLPFQRGSPFELSFLVLSSCFQVMLNGSLFVQYPHRVPFHHVDTLSVTGAVQ 128

Query: 122 IKCVAFE 128
           +  ++F+
Sbjct: 129 LSSISFQ 135



 Score = 42.4 bits (98), Expect = 0.014,   Method: Composition-based stats.
 Identities = 37/123 (30%), Positives = 57/123 (46%), Gaps = 12/123 (9%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAE 68
           L P   + V G +  +A+ F +NL  G D     NPRFN     N++V NS   G+WG E
Sbjct: 147 LYPSRRIIVSGTILPNAQWFRINLRSGSDIAFHLNPRFNE----NSVVRNSLINGSWGHE 202

Query: 69  QRE--SAFPFQPGS--VVEVFNQTD-LTIKLPDGYEFKFPNRL-NLEAINYLSAGGDFKI 122
           +R      PF  G    V +  +     + +   ++F + +R+ N  AIN L   G  ++
Sbjct: 203 ERSLWGPMPFIQGQSFTVRITRKAHYFRVAVNGVHKFDYNHRMKNFCAINVLDVAGHIRL 262

Query: 123 KCV 125
             V
Sbjct: 263 THV 265


>ref|XP_001915607.1| PREDICTED: similar to urate transporter/channel protein (UATp),
           partial [Equus caballus]
          Length = 148

 Score = 57.4 bits (137), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 36/127 (28%), Positives = 65/127 (51%), Gaps = 12/127 (9%)

Query: 11  LKPGECLRVRGEV-AADAKSFLLNL--GKDDNNLC---NPRFNAHGDVNTIVCNSKDAGA 64
           L+ G  + VRG V  +    F +N   G+ D+++    NPRF   G   ++VCN+K  G 
Sbjct: 25  LQEGLEITVRGTVLPSSGTRFAVNFQTGRSDDDIAFHFNPRFEEGG---SVVCNTKKKGL 81

Query: 65  WGAEQRESAFPFQPGSVVE---VFNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFK 121
           WG E++++  PFQ GS  E   +   +   + L      ++P+R+    ++ LS  G  +
Sbjct: 82  WGLEEKKTHLPFQRGSPFELSFLVLSSCFQVMLNGSLFVQYPHRVPFHHVDTLSVTGAVQ 141

Query: 122 IKCVAFE 128
           +  ++F+
Sbjct: 142 LSSISFQ 148


>sp|P82447|LEG1_PODHI RecName: Full=Galectin-1
          Length = 58

 Score = 57.0 bits (136), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 26/57 (45%), Positives = 42/57 (73%), Gaps = 3/57 (5%)

Query: 3  GLVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNLC---NPRFNAHGDVNTIV 56
          G+  ++L++ PG  L V+G++ A AKS+++NLGK +N++    N RF+AHGD+ TIV
Sbjct: 2  GITXTSLHVAPGARLAVKGDIPAGAKSWVINLGKGENDIMLHFNARFDAHGDIRTIV 58


>pdb|1WLW|A Chain A, Congerin Ii Y16s Single Mutant
          Length = 135

 Score = 57.0 bits (136), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 40/129 (31%), Positives = 62/129 (48%), Gaps = 9/129 (6%)

Query: 8   NLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNLC---NPRFNAHGDVNTIVCNS--KDA 62
           N+  K G  L V G V ++A  F +N+G+  +++    + RF+   D N +V NS   + 
Sbjct: 8   NIPFKLGMSLTVGGVVNSNATRFSINVGESTDSIAMHMDHRFSYGADQNVLVLNSLVHNV 67

Query: 63  GAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGD 119
           G W  E+R   FPF  G   +    F+     I+L +G   +FPNR    A N +   GD
Sbjct: 68  G-WQQEERSKKFPFTKGDHFQTTITFDTHTFYIQLSNGETVEFPNRNKDAAFNLIYLAGD 126

Query: 120 FKIKCVAFE 128
            ++  V  E
Sbjct: 127 ARLTFVRLE 135


>gb|AAB19412.2| beta-galactoside binding protein [Homo sapiens]
          Length = 30

 Score = 56.6 bits (135), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 26/30 (86%), Positives = 29/30 (96%)

Query: 99  EFKFPNRLNLEAINYLSAGGDFKIKCVAFE 128
           EFKFPNRLNLEAINY++A GDFKIKCVAF+
Sbjct: 1   EFKFPNRLNLEAINYIAADGDFKIKCVAFD 30


>sp|Q9YIC2|LEG2_CONMY RecName: Full=Congerin-2; AltName: Full=Congerin II; AltName:
           Full=Beta-galactoside-binding lectin 2
 dbj|BAA36386.1| Conger eel galectin (Congerin II) [Conger myriaster]
          Length = 136

 Score = 56.6 bits (135), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 40/129 (31%), Positives = 62/129 (48%), Gaps = 9/129 (6%)

Query: 8   NLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNLC---NPRFNAHGDVNTIVCNS--KDA 62
           N+  K G  L V G V ++A  F +N+G+  +++    + RF+   D N +V NS   + 
Sbjct: 9   NIPFKLGMYLTVGGVVNSNATRFSINVGESTDSIAMHMDHRFSYGADQNVLVLNSLVHNV 68

Query: 63  GAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGD 119
           G W  E+R   FPF  G   +    F+     I+L +G   +FPNR    A N +   GD
Sbjct: 69  G-WQQEERSKKFPFTKGDHFQTTITFDTHTFYIQLSNGETVEFPNRNKDAAFNLIYLAGD 127

Query: 120 FKIKCVAFE 128
            ++  V  E
Sbjct: 128 ARLTFVRLE 136


>gb|AAA41378.1| IgE binding protein
          Length = 138

 Score = 56.6 bits (135), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 39/116 (33%), Positives = 60/116 (51%), Gaps = 7/116 (6%)

Query: 13  PGECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAEQR 70
           P   + + G V  +A S  LN   G D     NPRFN + +   IVCN+K    WG E+R
Sbjct: 16  PRMLITIIGTVKPNANSITLNFKKGNDIAFHFNPRFNEN-NRRVIVCNTKQDNNWGREER 74

Query: 71  ESAFPFQPGS--VVEVFNQTD-LTIKLPDGYEFKFPNRL-NLEAINYLSAGGDFKI 122
           +SAFPF+ G    ++V  + D   + + D +  ++ +R+ NL  I+ L   GD  +
Sbjct: 75  QSAFPFESGKPFKIQVLVEADHFKVAVNDVHLLQYNHRMKNLREISQLGIIGDITL 130


>gb|EDL20743.1| lectin, galactose binding, soluble 3, isoform CRA_b [Mus musculus]
          Length = 124

 Score = 56.6 bits (135), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 37/116 (31%), Positives = 60/116 (51%), Gaps = 7/116 (6%)

Query: 13  PGECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAEQR 70
           P   + + G V  +A   +L+   G D     NPRFN + +   IVCN+K    WG E+R
Sbjct: 2   PRMLITIMGTVKPNANRIVLDFRRGNDVAFHFNPRFNEN-NRRVIVCNTKQDNNWGKEER 60

Query: 71  ESAFPFQPGS--VVEVFNQTD-LTIKLPDGYEFKFPNRL-NLEAINYLSAGGDFKI 122
           +SAFPF+ G    ++V  + D   + + D +  ++ +R+ NL  I+ L   GD  +
Sbjct: 61  QSAFPFESGKPFKIQVLVEADHFKVAVNDAHLLQYNHRMKNLREISQLGISGDITL 116


>gb|EEC12826.1| galectin, putative [Ixodes scapularis]
          Length = 307

 Score = 56.6 bits (135), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 41/127 (32%), Positives = 61/127 (48%), Gaps = 12/127 (9%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNLGKDDNNLC------NPRFNAHGDVNTIVCNSKDAGA 64
           + PG  + V GEV   A+ F +NL  D  +        NPRF+   +   +V NS+D   
Sbjct: 182 MTPGRVVIVSGEVEPTAQRFYVNLQTDVGDTADVGLHINPRFDT--NPRGVVLNSRDRDQ 239

Query: 65  WGAE-QRESAFPFQPGSVVE--VFNQTDLTIKLPDG-YEFKFPNRLNLEAINYLSAGGDF 120
           W +E Q    FPF PGS  E  +  Q D    + +G +   FP+R++L  I+Y+   G  
Sbjct: 240 WQSEVQVTEKFPFVPGSPFELQIHCQEDKFRLIVNGCFLANFPHRIDLSRIDYICVDGSL 299

Query: 121 KIKCVAF 127
            +  V F
Sbjct: 300 VVDRVVF 306



 Score = 38.9 bits (89), Expect = 0.14,   Method: Composition-based stats.
 Identities = 29/100 (29%), Positives = 46/100 (46%), Gaps = 9/100 (9%)

Query: 34  LGKDDNNL--CNPRFNAHGDVNTIVCNSKDAGAWGAEQRESAFPF---QPGSVVEVFNQT 88
           +GKDD+     NPRF      + IV NS   G+WG E+R+   P    QP  +     + 
Sbjct: 21  MGKDDDVALHVNPRFAE----SAIVRNSLKGGSWGEEERDGEMPLAIGQPFRLSVAVLED 76

Query: 89  DLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFKIKCVAFE 128
              + + D +   + +RL++ ++  L   GD  I  V  E
Sbjct: 77  CFRLTINDAHFADYAHRLSVGSVRNLVVEGDAVIHDVVVE 116


>pdb|1IS3|A Chain A, Lactose And Mes-Liganded Congerin Ii
 pdb|1IS4|A Chain A, Lactose-Liganded Congerin Ii
 pdb|1IS5|A Chain A, Ligand Free Congerin Ii
 pdb|1IS6|A Chain A, Mes-Liganded Congerin Ii
          Length = 135

 Score = 56.6 bits (135), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 40/129 (31%), Positives = 62/129 (48%), Gaps = 9/129 (6%)

Query: 8   NLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNLC---NPRFNAHGDVNTIVCNS--KDA 62
           N+  K G  L V G V ++A  F +N+G+  +++    + RF+   D N +V NS   + 
Sbjct: 8   NIPFKLGMYLTVGGVVNSNATRFSINVGESTDSIAMHMDHRFSYGADQNVLVLNSLVHNV 67

Query: 63  GAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGD 119
           G W  E+R   FPF  G   +    F+     I+L +G   +FPNR    A N +   GD
Sbjct: 68  G-WQQEERSKKFPFTKGDHFQTTITFDTHTFYIQLSNGETVEFPNRNKDAAFNLIYLAGD 126

Query: 120 FKIKCVAFE 128
            ++  V  E
Sbjct: 127 ARLTFVRLE 135


>gb|EDL88351.1| lectin, galactose binding, soluble 3, isoform CRA_b [Rattus
           norvegicus]
          Length = 142

 Score = 56.2 bits (134), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 39/116 (33%), Positives = 60/116 (51%), Gaps = 7/116 (6%)

Query: 13  PGECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAEQR 70
           P   + + G V  +A S  LN   G D     NPRFN + +   IVCN+K    WG E+R
Sbjct: 20  PRMLITIIGTVKPNANSITLNFKKGNDIAFHFNPRFNEN-NRRVIVCNTKQDNNWGREER 78

Query: 71  ESAFPFQPGS--VVEVFNQTD-LTIKLPDGYEFKFPNRL-NLEAINYLSAGGDFKI 122
           +SAFPF+ G    ++V  + D   + + D +  ++ +R+ NL  I+ L   GD  +
Sbjct: 79  QSAFPFESGKPFKIQVLVEADHFKVAVNDVHLLQYNHRMKNLREISQLGIIGDITL 134


>ref|NP_001009251.1| galectin-14 [Ovis aries]
 gb|AAL37895.1|AF443208_1 galectin-14 [Ovis aries]
          Length = 162

 Score = 56.2 bits (134), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 37/128 (28%), Positives = 61/128 (47%), Gaps = 13/128 (10%)

Query: 11  LKPGECLRVRGEV-AADAKSFLLNLG---KDDNNLC---NPRFNAHGDVNTIVCNSKDAG 63
           L+ G  + V G V + D   F ++      D NN+    NPRF   G    +VCN+   G
Sbjct: 37  LQDGHKVTVMGRVLSTDENRFQVDFQMGISDTNNVAFHFNPRFEGSG---YVVCNTMQLG 93

Query: 64  AWGAEQRESAFPFQPGSVVEVFNQTD---LTIKLPDGYEFKFPNRLNLEAINYLSAGGDF 120
            WG E+++   PFQ GS+ E+  + D     + +       + +RL  E +N +S GG  
Sbjct: 94  NWGPEEKKMQMPFQKGSLFEICFKVDSSSFKVTVNGSIFLDYAHRLPFEQVNAISIGGCV 153

Query: 121 KIKCVAFE 128
            +  ++F+
Sbjct: 154 HVSYISFQ 161


>gb|EDL88352.1| lectin, galactose binding, soluble 3, isoform CRA_c [Rattus
           norvegicus]
 gb|EDL88353.1| lectin, galactose binding, soluble 3, isoform CRA_c [Rattus
           norvegicus]
 gb|EDL88354.1| lectin, galactose binding, soluble 3, isoform CRA_c [Rattus
           norvegicus]
 gb|EDL88355.1| lectin, galactose binding, soluble 3, isoform CRA_c [Rattus
           norvegicus]
          Length = 131

 Score = 56.2 bits (134), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 39/116 (33%), Positives = 60/116 (51%), Gaps = 7/116 (6%)

Query: 13  PGECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAEQR 70
           P   + + G V  +A S  LN   G D     NPRFN + +   IVCN+K    WG E+R
Sbjct: 9   PRMLITIIGTVKPNANSITLNFKKGNDIAFHFNPRFNEN-NRRVIVCNTKQDNNWGREER 67

Query: 71  ESAFPFQPGS--VVEVFNQTD-LTIKLPDGYEFKFPNRL-NLEAINYLSAGGDFKI 122
           +SAFPF+ G    ++V  + D   + + D +  ++ +R+ NL  I+ L   GD  +
Sbjct: 68  QSAFPFESGKPFKIQVLVEADHFKVAVNDVHLLQYNHRMKNLREISQLGIIGDITL 123


>dbj|BAE43211.1| unnamed protein product [Mus musculus]
          Length = 186

 Score = 55.5 bits (132), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 37/116 (31%), Positives = 60/116 (51%), Gaps = 7/116 (6%)

Query: 13  PGECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAEQR 70
           P   + + G V  +A   +L+   G D     NPRFN + +   IVCN+K    WG E+R
Sbjct: 64  PRMLITIMGTVKPNANRIVLDFRRGNDVAFHFNPRFNEN-NRRVIVCNTKQDNNWGKEER 122

Query: 71  ESAFPFQPGS--VVEVFNQTD-LTIKLPDGYEFKFPNRL-NLEAINYLSAGGDFKI 122
           +SAFPF+ G    ++V  + D   + + D +  ++ +R+ NL  I+ L   GD  +
Sbjct: 123 QSAFPFESGKPFKIQVLVEADHFKVAVNDAHLLQYNHRMKNLREISQLGISGDITL 178


>ref|NP_001015570.1| galectin-9 isoform 2 [Bos taurus]
 gb|AAX08997.1| galectin 9 short isoform [Bos taurus]
          Length = 323

 Score = 55.1 bits (131), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 40/123 (32%), Positives = 61/123 (49%), Gaps = 12/123 (9%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAE 68
           L P + + V G +   A+ F +NL  G D     NPRFN     N +V N++  G+WG+E
Sbjct: 203 LYPSKSILVSGTILPSAQRFYINLRSGSDIAFHLNPRFNE----NAVVRNTQINGSWGSE 258

Query: 69  QRE--SAFPFQPGSVVEVFNQTD---LTIKLPDGYEFKFPNRL-NLEAINYLSAGGDFKI 122
           +R      PF  G    V+   +     + +   + F++ +RL NL AIN L  GGD ++
Sbjct: 259 ERSLPRGMPFFRGQSFSVWIMCEGHCFKVAVDSQHLFEYHHRLKNLPAINNLEVGGDIQL 318

Query: 123 KCV 125
             V
Sbjct: 319 THV 321



 Score = 49.7 bits (117), Expect = 8e-05,   Method: Composition-based stats.
 Identities = 34/127 (26%), Positives = 64/127 (50%), Gaps = 12/127 (9%)

Query: 11  LKPGECLRVRGEV-AADAKSFLLNL--GKDDNNLC---NPRFNAHGDVNTIVCNSKDAGA 64
           L+ G  + + G V  +    F +NL  G +D+++    NPRF   G    +VCN+K  G+
Sbjct: 25  LQDGHKITIIGAVLPSGGNRFAVNLQTGYNDSDIAFHFNPRFEEGG---YVVCNTKQRGS 81

Query: 65  WGAEQRESAFPFQPGSVVEVFNQ---TDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFK 121
           WG E+R+   PFQ G   E+  Q   ++  + +      ++ +R+    I+ +S  G  +
Sbjct: 82  WGTEERKMHMPFQRGCSFELCFQVQSSEFRVMVNGNLFTQYAHRVPFHRIDAISITGVVQ 141

Query: 122 IKCVAFE 128
           +  ++F+
Sbjct: 142 LSSISFQ 148


>ref|NP_072104.2| lectin, galactose binding, soluble 7 [Rattus norvegicus]
 sp|P97590|LEG7_RAT RecName: Full=Galectin-7; Short=Gal-7
 gb|EDM07867.1| rCG54103, isoform CRA_a [Rattus norvegicus]
 gb|EDM07868.1| rCG54103, isoform CRA_a [Rattus norvegicus]
          Length = 136

 Score = 55.1 bits (131), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 34/120 (28%), Positives = 54/120 (45%), Gaps = 5/120 (4%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAE 68
           ++ G  +R+RG V   A  F +NL  G++        FN   D + +V N+K  G WG E
Sbjct: 14  VRLGTVMRIRGVVPDQAGRFHVNLLCGEEQEADAALHFNPRLDTSEVVFNTKQQGKWGRE 73

Query: 69  QRESAFPFQPGSVVEVF---NQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFKIKCV 125
           +R +  PFQ G   EV     +      + D     F +R+    +  +  GGD ++  V
Sbjct: 74  ERGTGIPFQRGQPFEVLIITTEEGFKTVIGDDEYLHFHHRMPSSNVRSVEVGGDVQLHSV 133


>gb|AAB88871.1| galectin-7 [Rattus norvegicus]
          Length = 132

 Score = 55.1 bits (131), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 34/120 (28%), Positives = 54/120 (45%), Gaps = 5/120 (4%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAE 68
           ++ G  +R+RG V   A  F +NL  G++        FN   D + +V N+K  G WG E
Sbjct: 10  VRLGTVMRIRGVVPDQAGRFHVNLLCGEEQEADAALHFNPRLDTSEVVFNTKQQGKWGRE 69

Query: 69  QRESAFPFQPGSVVEVF---NQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFKIKCV 125
           +R +  PFQ G   EV     +      + D     F +R+    +  +  GGD ++  V
Sbjct: 70  ERGTGIPFQRGQPFEVLIITTEEGFKTVIGDDEYLHFHHRMPSSNVRSVEVGGDVQLHSV 129


>ref|NP_001034266.1| galectin-9 isoform 1 [Bos taurus]
          Length = 355

 Score = 54.7 bits (130), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 40/123 (32%), Positives = 61/123 (49%), Gaps = 12/123 (9%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAE 68
           L P + + V G +   A+ F +NL  G D     NPRFN     N +V N++  G+WG+E
Sbjct: 235 LYPSKSILVSGTILPSAQRFYINLRSGSDIAFHLNPRFNE----NAVVRNTQINGSWGSE 290

Query: 69  QRE--SAFPFQPGSVVEVFNQTD---LTIKLPDGYEFKFPNRL-NLEAINYLSAGGDFKI 122
           +R      PF  G    V+   +     + +   + F++ +RL NL AIN L  GGD ++
Sbjct: 291 ERSLPRGMPFFRGQSFSVWIMCEGHCFKVAVDSQHLFEYHHRLKNLPAINNLEVGGDIQL 350

Query: 123 KCV 125
             V
Sbjct: 351 THV 353



 Score = 49.3 bits (116), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 34/127 (26%), Positives = 64/127 (50%), Gaps = 12/127 (9%)

Query: 11  LKPGECLRVRGEV-AADAKSFLLNL--GKDDNNLC---NPRFNAHGDVNTIVCNSKDAGA 64
           L+ G  + + G V  +    F +NL  G +D+++    NPRF   G    +VCN+K  G+
Sbjct: 25  LQDGHKITIIGAVLPSGGNRFAVNLQTGYNDSDIAFHFNPRFEEGG---YVVCNTKQRGS 81

Query: 65  WGAEQRESAFPFQPGSVVEVFNQ---TDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFK 121
           WG E+R+   PFQ G   E+  Q   ++  + +      ++ +R+    I+ +S  G  +
Sbjct: 82  WGTEERKMHMPFQRGCSFELCFQVQSSEFRVMVNGNLFTQYAHRVPFHRIDAISITGVVQ 141

Query: 122 IKCVAFE 128
           +  ++F+
Sbjct: 142 LSSISFQ 148


>sp|Q3MHZ8|LEG9_BOVIN RecName: Full=Galectin-9
 gb|AAI04506.1| Lectin, galactoside-binding, soluble, 9 [Bos taurus]
          Length = 355

 Score = 54.7 bits (130), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 40/123 (32%), Positives = 61/123 (49%), Gaps = 12/123 (9%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAE 68
           L P + + V G +   A+ F +NL  G D     NPRFN     N +V N++  G+WG+E
Sbjct: 235 LYPSKSILVSGTILPSAQRFYINLRSGSDIAFHLNPRFNE----NAVVRNTQINGSWGSE 290

Query: 69  QRE--SAFPFQPGSVVEVFNQTD---LTIKLPDGYEFKFPNRL-NLEAINYLSAGGDFKI 122
           +R      PF  G    V+   +     + +   + F++ +RL NL AIN L  GGD ++
Sbjct: 291 ERSLPRGMPFFRGQSFSVWIMCEGHCFKVAVDSQHLFEYHHRLKNLPAINNLEVGGDIQL 350

Query: 123 KCV 125
             V
Sbjct: 351 THV 353



 Score = 50.8 bits (120), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 35/127 (27%), Positives = 64/127 (50%), Gaps = 12/127 (9%)

Query: 11  LKPGECLRVRGEV-AADAKSFLLNL--GKDDNNLC---NPRFNAHGDVNTIVCNSKDAGA 64
           L+ G  + + G V  +    F +NL  G +D+++    NPRF   G    +VCN+K  G+
Sbjct: 25  LQDGHKITIIGAVLPSGGNRFAVNLQTGYNDSDIAFHFNPRFEEGG---YVVCNTKQRGS 81

Query: 65  WGAEQRESAFPFQPGSVVEVFNQ---TDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFK 121
           WG E+R+   PFQ G   E+  Q   +D  + +      ++ +R+    I+ +S  G  +
Sbjct: 82  WGTEERKMHMPFQRGCSFELCFQVQSSDFRVMVNGNLFTQYAHRVPFHRIDAISITGVVQ 141

Query: 122 IKCVAFE 128
           +  ++F+
Sbjct: 142 LSSISFQ 148


>ref|NP_001136315.1| lectin, galactoside-binding, soluble, 7 [Sus scrofa]
 gb|ACJ64062.1| lectin galactoside-binding soluble 7 protein [Sus scrofa]
          Length = 138

 Score = 54.7 bits (130), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 38/120 (31%), Positives = 61/120 (50%), Gaps = 5/120 (4%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAE 68
           ++ G  +R+RG V   A  F +NL  G++  +     FN   D +++V NS + GAWG E
Sbjct: 16  IRVGTVMRIRGVVPDQAGRFYVNLLCGEEPGSEAALHFNPRLDESSVVFNSLEHGAWGRE 75

Query: 69  QRESAFPFQPGSVVEV-FNQTDLTIKLPDG-YEF-KFPNRLNLEAINYLSAGGDFKIKCV 125
           +R    PFQ G   +V    TD   K+  G  E+  F +R+    +  +  GGD +++ V
Sbjct: 76  ERGPGIPFQRGQPFDVLLITTDEGFKVVVGDLEYHHFRHRMPPTRVRAVEVGGDLQLELV 135


>gb|EDL20744.1| lectin, galactose binding, soluble 3, isoform CRA_c [Mus musculus]
          Length = 273

 Score = 54.3 bits (129), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 37/116 (31%), Positives = 60/116 (51%), Gaps = 7/116 (6%)

Query: 13  PGECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAEQR 70
           P   + + G V  +A   +L+   G D     NPRFN + +   IVCN+K    WG E+R
Sbjct: 151 PRMLITIMGTVKPNANRIVLDFRRGNDVAFHFNPRFNEN-NRRVIVCNTKQDNNWGKEER 209

Query: 71  ESAFPFQPGS--VVEVFNQTD-LTIKLPDGYEFKFPNRL-NLEAINYLSAGGDFKI 122
           +SAFPF+ G    ++V  + D   + + D +  ++ +R+ NL  I+ L   GD  +
Sbjct: 210 QSAFPFESGKPFKIQVLVEADHFKVAVNDAHLLQYNHRMKNLREISQLGISGDITL 265


>emb|CAA34206.1| unnamed protein product [Mus sp.]
          Length = 264

 Score = 54.3 bits (129), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 37/116 (31%), Positives = 60/116 (51%), Gaps = 7/116 (6%)

Query: 13  PGECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAEQR 70
           P   + + G V  +A   +L+   G D     NPRFN + +   IVCN+K    WG E+R
Sbjct: 142 PRMLITIMGTVKPNANRIVLDFRRGNDVAFHFNPRFNEN-NRRVIVCNTKQDNNWGKEER 200

Query: 71  ESAFPFQPGS--VVEVFNQTD-LTIKLPDGYEFKFPNRL-NLEAINYLSAGGDFKI 122
           +SAFPF+ G    ++V  + D   + + D +  ++ +R+ NL  I+ L   GD  +
Sbjct: 201 QSAFPFESGKPFKIQVLVEADHFKVAVNDAHLLQYNHRMKNLREISQLGISGDITL 256


>sp|P16110|LEG3_MOUSE RecName: Full=Galectin-3; AltName: Full=Galactose-specific lectin
           3; AltName: Full=Mac-2 antigen; AltName:
           Full=IgE-binding protein; AltName: Full=35 kDa lectin;
           AltName: Full=Carbohydrate-binding protein 35; Short=CBP
           35; AltName: Full=Laminin-binding protein; AltName:
           Full=Lectin L-29; AltName: Full=L-34 galactoside-binding
           lectin
 emb|CAA34736.1| unnamed protein product [Mus musculus]
          Length = 264

 Score = 54.3 bits (129), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 37/116 (31%), Positives = 60/116 (51%), Gaps = 7/116 (6%)

Query: 13  PGECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAEQR 70
           P   + + G V  +A   +L+   G D     NPRFN + +   IVCN+K    WG E+R
Sbjct: 142 PRMLITIMGTVKPNANRIVLDFRRGNDVAFHFNPRFNEN-NRRVIVCNTKQDNNWGKEER 200

Query: 71  ESAFPFQPGS--VVEVFNQTD-LTIKLPDGYEFKFPNRL-NLEAINYLSAGGDFKI 122
           +SAFPF+ G    ++V  + D   + + D +  ++ +R+ NL  I+ L   GD  +
Sbjct: 201 QSAFPFESGKPFKIQVLVEADHFKVAVNDAHLLQYNHRMKNLREISQLGISGDITL 256


>ref|NP_034835.1| galectin 3 [Mus musculus]
 ref|NP_001139425.1| galectin 3 [Mus musculus]
 dbj|BAC40813.1| unnamed protein product [Mus musculus]
 dbj|BAE35163.1| unnamed protein product [Mus musculus]
 dbj|BAE33287.1| unnamed protein product [Mus musculus]
 dbj|BAE29081.1| unnamed protein product [Mus musculus]
 dbj|BAE42038.1| unnamed protein product [Mus musculus]
 gb|AAI32329.1| Lectin, galactose binding, soluble 3 [Mus musculus]
 gb|EDL20742.1| lectin, galactose binding, soluble 3, isoform CRA_a [Mus musculus]
 gb|EDL20745.1| lectin, galactose binding, soluble 3, isoform CRA_d [Mus musculus]
 gb|AAI38791.1| Lectin, galactose binding, soluble 3 [Mus musculus]
 gb|AAI45420.1| Lectin, galactose binding, soluble 3 [Mus musculus]
          Length = 264

 Score = 54.3 bits (129), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 37/116 (31%), Positives = 60/116 (51%), Gaps = 7/116 (6%)

Query: 13  PGECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAEQR 70
           P   + + G V  +A   +L+   G D     NPRFN + +   IVCN+K    WG E+R
Sbjct: 142 PRMLITIMGTVKPNANRIVLDFRRGNDVAFHFNPRFNEN-NRRVIVCNTKQDNNWGKEER 200

Query: 71  ESAFPFQPGS--VVEVFNQTD-LTIKLPDGYEFKFPNRL-NLEAINYLSAGGDFKI 122
           +SAFPF+ G    ++V  + D   + + D +  ++ +R+ NL  I+ L   GD  +
Sbjct: 201 QSAFPFESGKPFKIQVLVEADHFKVAVNDAHLLQYNHRMKNLREISQLGISGDITL 256


>sp|O54974|LEG7_MOUSE RecName: Full=Galectin-7; Short=Gal-7
 gb|AAB92566.1| galectin-7 [Mus musculus]
          Length = 136

 Score = 54.3 bits (129), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 34/117 (29%), Positives = 53/117 (45%), Gaps = 5/117 (4%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAE 68
           ++ G  +R+RG V   A  F +NL  G++        FN   D + +V N+K  G WG E
Sbjct: 14  VRVGTVMRIRGLVPDQAGRFHVNLLCGEEQGADAALHFNPRLDTSEVVFNTKQQGKWGRE 73

Query: 69  QRESAFPFQPGSVVEVF---NQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFKI 122
           +R +  PFQ G   EV     +      + D     F +RL    +  +  GGD ++
Sbjct: 74  ERGTGIPFQRGQPFEVLLIATEEGFKAVVGDDEYLHFHHRLPPARVRLVEVGGDVQL 130


>ref|NP_032522.2| lectin, galactose binding, soluble 7 [Mus musculus]
 dbj|BAB22607.1| unnamed protein product [Mus musculus]
 dbj|BAB25887.1| unnamed protein product [Mus musculus]
 gb|AAI16841.1| Lectin, galactose binding, soluble 7 [Mus musculus]
 gb|AAI16839.1| Lectin, galactose binding, soluble 7 [Mus musculus]
 gb|EDL24104.1| lectin, galactose binding, soluble 7, isoform CRA_a [Mus musculus]
 gb|EDL24105.1| lectin, galactose binding, soluble 7, isoform CRA_a [Mus musculus]
          Length = 136

 Score = 54.3 bits (129), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 33/120 (27%), Positives = 56/120 (46%), Gaps = 5/120 (4%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAE 68
           ++ G  +R+RG V   A  F +NL  G++        FN   D + +V N+K+ G WG E
Sbjct: 14  VRVGTVMRIRGMVPDQAGRFHVNLLCGEEQGADAALHFNPRLDTSEVVFNTKEQGKWGRE 73

Query: 69  QRESAFPF---QPGSVVEVFNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFKIKCV 125
           +R +  PF   QP  V+ +  +      + D     F +R+    +  +  GGD ++  V
Sbjct: 74  ERGTGIPFERGQPFEVLLIATEEGFKAVVGDDEYLHFHHRMPPARVRLVEVGGDVQLHSV 133


>dbj|BAB26108.1| unnamed protein product [Mus musculus]
          Length = 136

 Score = 54.3 bits (129), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 33/120 (27%), Positives = 56/120 (46%), Gaps = 5/120 (4%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAE 68
           ++ G  +R+RG V   A  F +NL  G++        FN   D + +V N+K+ G WG E
Sbjct: 14  VRVGTVMRIRGMVPDQAGRFHVNLLCGEEQGADAALHFNPRLDTSEVVFNTKEQGKWGRE 73

Query: 69  QRESAFPF---QPGSVVEVFNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFKIKCV 125
           +R +  PF   QP  V+ +  +      + D     F +R+    +  +  GGD ++  V
Sbjct: 74  ERGTGIPFERGQPFEVLLIATEEGFKAVVGDDEYLHFHHRMPPALVRLVEVGGDVQLHSV 133


>sp|P08699|LEG3_RAT RecName: Full=Galectin-3; AltName: Full=Galactose-specific lectin
           3; AltName: Full=Mac-2 antigen; AltName:
           Full=IgE-binding protein; AltName: Full=35 kDa lectin;
           AltName: Full=Carbohydrate-binding protein 35; Short=CBP
           35; AltName: Full=Laminin-binding protein; AltName:
           Full=Lectin L-29
 gb|AAH89054.1| Lectin, galactoside-binding, soluble, 3 [Rattus norvegicus]
 gb|EDL88350.1| lectin, galactose binding, soluble 3, isoform CRA_a [Rattus
           norvegicus]
          Length = 262

 Score = 53.9 bits (128), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 39/116 (33%), Positives = 60/116 (51%), Gaps = 7/116 (6%)

Query: 13  PGECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAEQR 70
           P   + + G V  +A S  LN   G D     NPRFN + +   IVCN+K    WG E+R
Sbjct: 140 PRMLITIIGTVKPNANSITLNFKKGNDIAFHFNPRFNEN-NRRVIVCNTKQDNNWGREER 198

Query: 71  ESAFPFQPGS--VVEVFNQTD-LTIKLPDGYEFKFPNRL-NLEAINYLSAGGDFKI 122
           +SAFPF+ G    ++V  + D   + + D +  ++ +R+ NL  I+ L   GD  +
Sbjct: 199 QSAFPFESGKPFKIQVLVEADHFKVAVNDVHLLQYNHRMKNLREISQLGIIGDITL 254


>ref|NP_114020.1| galectin 3 [Rattus norvegicus]
 gb|AAA40828.1| IgE binding protein
          Length = 262

 Score = 53.9 bits (128), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 39/116 (33%), Positives = 60/116 (51%), Gaps = 7/116 (6%)

Query: 13  PGECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAEQR 70
           P   + + G V  +A S  LN   G D     NPRFN + +   IVCN+K    WG E+R
Sbjct: 140 PRMLITIIGTVKPNANSITLNFKKGNDIAFHFNPRFNEN-NRRVIVCNTKQDNNWGREER 198

Query: 71  ESAFPFQPGS--VVEVFNQTD-LTIKLPDGYEFKFPNRL-NLEAINYLSAGGDFKI 122
           +SAFPF+ G    ++V  + D   + + D +  ++ +R+ NL  I+ L   GD  +
Sbjct: 199 QSAFPFESGKPFKIQVLVEADHFKVAVNDVHLLQYNHRMKNLREISQLGIIGDITL 254


>ref|NP_001003345.1| galectin-9 [Canis lupus familiaris]
 gb|AAS80311.1| galectin 9 [Canis familiaris]
          Length = 323

 Score = 53.9 bits (128), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 28/100 (28%), Positives = 53/100 (53%), Gaps = 9/100 (9%)

Query: 35  GKDDNNLC---NPRFNAHGDVNTIVCNSKDAGAWGAEQRESAFPFQPGSVVEV---FNQT 88
           G  D+++    NPRF   G    +VCN+K  G+WG+E+R+   PFQ G+  E+    N  
Sbjct: 52  GHSDSDIAFHFNPRFEEGG---YVVCNTKQKGSWGSEERKMQMPFQMGNPFELCFMVNSC 108

Query: 89  DLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFKIKCVAFE 128
           D  + +   +  ++ +R+    ++ LS  G  ++  ++F+
Sbjct: 109 DFKVTVNGSHFTQYSHRVPFHYVDTLSITGAVQLSYISFQ 148



 Score = 49.7 bits (117), Expect = 9e-05,   Method: Composition-based stats.
 Identities = 40/123 (32%), Positives = 59/123 (47%), Gaps = 12/123 (9%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAE 68
           L P + + V G V   AK F +NL  G D     NPRFN     NT+V N +   +WG+E
Sbjct: 203 LYPSKSIIVSGTVLPGAKRFHINLRSGNDIAFHLNPRFNE----NTVVRNMQINNSWGSE 258

Query: 69  QRE--SAFPFQPGSVVEVFNQTD---LTIKLPDGYEFKFPNRL-NLEAINYLSAGGDFKI 122
           +R      PF  G    V+   +     + +   + F++ +RL NL AIN +   GD ++
Sbjct: 259 ERSLPRKMPFVQGQSFSVWIMCEGHCFKVAVDGEHLFEYYHRLKNLLAINNMEVAGDVQL 318

Query: 123 KCV 125
             V
Sbjct: 319 THV 321


>ref|XP_001519384.1| PREDICTED: similar to galectin-7 [Ornithorhynchus anatinus]
          Length = 241

 Score = 53.9 bits (128), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 36/125 (28%), Positives = 58/125 (46%), Gaps = 15/125 (12%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAE 68
           L+PG  +R+RG V  +A  F +N   G++        FN   D   +V NS + G+W  E
Sbjct: 119 LRPGSVVRLRGVVPQEAARFHVNFLCGEEAGADTALHFNPRMDTGEVVFNSFEGGSWKKE 178

Query: 69  QRESAFPFQPGSVVEVFNQTDLTIKLPDGYEF--------KFPNRLNLEAINYLSAGGDF 120
           +R    PF+ G   ++     L I   DGY+         +F +R+  + +  L  GGD 
Sbjct: 179 ERGRGLPFRRGEPFDL-----LLIAADDGYKVVIGDAEYHRFAHRVPPQRVRGLEVGGDV 233

Query: 121 KIKCV 125
            ++ V
Sbjct: 234 LLQAV 238


>ref|NP_001082204.1| galectin family xgalectin-IIa [Xenopus laevis]
 dbj|BAB83257.1| galectin family xgalectin-IIa [Xenopus laevis]
 gb|AAH75170.1| Xgalectin-IIa protein [Xenopus laevis]
          Length = 340

 Score = 53.9 bits (128), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 35/125 (28%), Positives = 61/125 (48%), Gaps = 13/125 (10%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL------GKDDNNLCNPRFNAHGDVNTIVCNSKDAGA 64
           L+ G  + V+G +  +   F +N       G D     NPRF+     + +V NS   G+
Sbjct: 27  LRAGMSVYVQGTIPNNITRFAVNFTCGQHDGADVACHFNPRFDGK---DKVVFNSMIGGS 83

Query: 65  WGAEQRES-AFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDF 120
           WG+E+++  +FPF+ G   E+    N +   I +     +KF +R+ LE +N L   GD 
Sbjct: 84  WGSEEKKKDSFPFRKGKSFELAFMINSSSFEITVNGSSFYKFKHRMPLERVNSLQVSGDV 143

Query: 121 KIKCV 125
            ++ +
Sbjct: 144 SVQAL 148



 Score = 45.4 bits (106), Expect = 0.001,   Method: Composition-based stats.
 Identities = 32/122 (26%), Positives = 61/122 (50%), Gaps = 5/122 (4%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNLGKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAEQR 70
           + P + + +RG +   A+ F +N     +N     FN     N++V NS+  G+WG E+R
Sbjct: 219 MSPRKTVIIRGFIPEGAERFHINFKAGSSNDVALHFNPRLTENSVVRNSRLGGSWGQEER 278

Query: 71  ESAF-PFQPGSVVEVFNQ--TDLTIKLPDGYEF-KFPNRLN-LEAINYLSAGGDFKIKCV 125
           + ++ PF+PG   ++  +   D      +G +F  F +R + L+ I+ +   G+  I  +
Sbjct: 279 QLSYNPFRPGQYFDISLRCGMDRFTVFVNGQQFCDFAHRYSMLQMIDRIEIEGNVVISLI 338

Query: 126 AF 127
            F
Sbjct: 339 QF 340


>ref|XP_001504125.1| PREDICTED: similar to galectin 9 short isoform 1 [Equus caballus]
          Length = 326

 Score = 53.5 bits (127), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 30/103 (29%), Positives = 51/103 (49%), Gaps = 9/103 (8%)

Query: 32  LNLGKDDNNLC---NPRFNAHGDVNTIVCNSKDAGAWGAEQRESAFPFQPGSVVEVF--- 85
             +G  DN++    NPRF   G    +VCN+K  G WG E+R+   PFQ GS  E+    
Sbjct: 49  FQIGSSDNDIAFHFNPRFENGG---YLVCNTKQNGCWGREERKMHLPFQRGSPFELIFLV 105

Query: 86  NQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFKIKCVAFE 128
             +   + L      ++P+R+    ++ LS  G  ++  ++F+
Sbjct: 106 QSSHFQVMLNGSPFVQYPHRVPFHRVDTLSINGIVQLFSISFQ 148



 Score = 43.9 bits (102), Expect = 0.004,   Method: Composition-based stats.
 Identities = 39/120 (32%), Positives = 55/120 (45%), Gaps = 12/120 (10%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAE 68
           L P + + V G V   A+ F +NL  G D     NPRF    D NT+V N+   G+WG E
Sbjct: 206 LYPSKRIFVSGTVLPSAQRFHINLRSGSDIAFHLNPRF----DENTVVRNTHVNGSWGHE 261

Query: 69  QRE--SAFPFQPGSVVEVFNQTD---LTIKLPDGYEFKFPNRL-NLEAINYLSAGGDFKI 122
           +R      PF  G    V    +   L + +   +   + +RL NL  IN L   GD ++
Sbjct: 262 ERSLCGKMPFTRGQSFSVCITCEGHCLRVVVDGQHLCDYNHRLKNLPGINNLEVAGDVQL 321


>gb|AAK29385.1|AF331640_1 beta-galactoside-binding protein galectin-7 [Mus musculus]
          Length = 136

 Score = 53.5 bits (127), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 32/117 (27%), Positives = 55/117 (47%), Gaps = 5/117 (4%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAE 68
           ++ G  +R+RG V   A  F +NL  G++        FN   D + +V N+K+ G WG E
Sbjct: 14  VRVGTVMRIRGMVPDQAGRFHVNLLCGEEQGADAALHFNPRLDTSEVVFNTKEQGKWGRE 73

Query: 69  QRESAFPF---QPGSVVEVFNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFKI 122
           +R +  PF   QP  V+ +  +      + D     F +R+    +  +  GGD ++
Sbjct: 74  ERGTGIPFERGQPFEVLLIATEEGFKAVVGDDEYLHFHHRMPPARVRLVEVGGDVQL 130


>ref|NP_001029940.1| galectin-4 [Bos taurus]
 sp|Q3T0D6|LEG4_BOVIN RecName: Full=Galectin-4
 gb|AAI02445.1| Lectin, galactoside-binding, soluble, 4 [Bos taurus]
          Length = 332

 Score = 53.1 bits (126), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 35/126 (27%), Positives = 63/126 (50%), Gaps = 12/126 (9%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL------GKDDNNLCNPRFNAHGDVNTIVCNSKDAGA 64
           L+ G  + ++G  +   K F +N       G D     NPRF+     + +V NSK  G+
Sbjct: 27  LRVGMSVYIQGVASEHMKRFFVNFEVGQGQGADVAFHFNPRFDGW---DKVVLNSKQNGS 83

Query: 65  WGAEQRESAFPFQPGSVVEV--FNQTDLTIKLPDGYEF-KFPNRLNLEAINYLSAGGDFK 121
           WG E+R+ + PF+ G+  E+     T+    + +G  F +F +R+ L+ + +L   GD  
Sbjct: 84  WGQEERKMSMPFRKGAAFELVFMVMTEHFKVVVNGTPFHEFKHRIPLQMVTHLHVDGDLM 143

Query: 122 IKCVAF 127
           ++ + F
Sbjct: 144 LQSINF 149



 Score = 36.2 bits (82), Expect = 0.86,   Method: Composition-based stats.
 Identities = 19/67 (28%), Positives = 34/67 (50%), Gaps = 1/67 (1%)

Query: 19  VRGEVAADAKSFLLNLGKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAEQRESAF-PFQ 77
           ++G +   AKSF++N     +       N       +V NS   G+WG+E+R+ ++ PF 
Sbjct: 219 IKGYIPPTAKSFVINFKVGSSGDVALHINPRMTEGAVVRNSFLNGSWGSEERKVSYNPFG 278

Query: 78  PGSVVEV 84
           PG   ++
Sbjct: 279 PGQFFDL 285


>gb|AAA16211.1| beta-galactosides-binding lectin
          Length = 285

 Score = 53.1 bits (126), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 37/123 (30%), Positives = 62/123 (50%), Gaps = 7/123 (5%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAE 68
           +KP   + + G V   A    L+   G D     NPRFN   +   IVCN+K    WG E
Sbjct: 161 VKPRMLITILGTVRPSANRLALDFKRGNDVAFHFNPRFN-EDNKRVIVCNTKLDNIWGKE 219

Query: 69  QRESAFPFQPGS--VVEVFNQTD-LTIKLPDGYEFKFPNRL-NLEAINYLSAGGDFKIKC 124
           +R++AFPF+ G    ++V  ++D   + + D +  ++ +R+ NL  I+ L   GD  +  
Sbjct: 220 ERQAAFPFESGKPFKIQVLVESDHFKVAVNDAHLLQYNHRMKNLPEISKLGISGDIDLTS 279

Query: 125 VAF 127
            ++
Sbjct: 280 ASY 282


>ref|XP_853675.1| PREDICTED: similar to Galectin-3 (Galactose-specific lectin 3)
           (Mac-2 antigen) (IgE-binding protein) (35 kDa lectin)
           (Carbohydrate binding protein 35) (CBP 35)
           (Laminin-binding protein) (Lectin L-29) (L-34
           galactoside-binding lectin) [Canis familiaris]
          Length = 287

 Score = 53.1 bits (126), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 37/123 (30%), Positives = 62/123 (50%), Gaps = 7/123 (5%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAE 68
           +KP   + + G V   A    L+   G D     NPRFN   +   IVCN+K    WG E
Sbjct: 163 VKPRMLITILGTVRPSANRLALDFKRGNDVAFHFNPRFN-EDNKRVIVCNTKLDNIWGKE 221

Query: 69  QRESAFPFQPGS--VVEVFNQTD-LTIKLPDGYEFKFPNRL-NLEAINYLSAGGDFKIKC 124
           +R++AFPF+ G    ++V  ++D   + + D +  ++ +R+ NL  I+ L   GD  +  
Sbjct: 222 ERQAAFPFESGKPFKIQVLVESDHFKVAVNDAHLLQYNHRMKNLPEISKLGISGDIDLTS 281

Query: 125 VAF 127
            ++
Sbjct: 282 ASY 284


>ref|XP_001504129.2| PREDICTED: similar to galectin 9 short isoform 3 [Equus caballus]
          Length = 358

 Score = 53.1 bits (126), Expect = 8e-06,   Method: Composition-based stats.
 Identities = 30/103 (29%), Positives = 51/103 (49%), Gaps = 9/103 (8%)

Query: 32  LNLGKDDNNLC---NPRFNAHGDVNTIVCNSKDAGAWGAEQRESAFPFQPGSVVEVF--- 85
             +G  DN++    NPRF   G    +VCN+K  G WG E+R+   PFQ GS  E+    
Sbjct: 49  FQIGSSDNDIAFHFNPRFENGG---YLVCNTKQNGCWGREERKMHLPFQRGSPFELIFLV 105

Query: 86  NQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFKIKCVAFE 128
             +   + L      ++P+R+    ++ LS  G  ++  ++F+
Sbjct: 106 QSSHFQVMLNGSPFVQYPHRVPFHRVDTLSINGIVQLFSISFQ 148



 Score = 43.5 bits (101), Expect = 0.006,   Method: Composition-based stats.
 Identities = 39/120 (32%), Positives = 55/120 (45%), Gaps = 12/120 (10%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAE 68
           L P + + V G V   A+ F +NL  G D     NPRF    D NT+V N+   G+WG E
Sbjct: 238 LYPSKRIFVSGTVLPSAQRFHINLRSGSDIAFHLNPRF----DENTVVRNTHVNGSWGHE 293

Query: 69  QRE--SAFPFQPGSVVEVFNQTD---LTIKLPDGYEFKFPNRL-NLEAINYLSAGGDFKI 122
           +R      PF  G    V    +   L + +   +   + +RL NL  IN L   GD ++
Sbjct: 294 ERSLCGKMPFTRGQSFSVCITCEGHCLRVVVDGQHLCDYNHRLKNLPGINNLEVAGDVQL 353


>ref|XP_001496714.1| PREDICTED: similar to galectin-7 [Equus caballus]
          Length = 140

 Score = 53.1 bits (126), Expect = 8e-06,   Method: Composition-based stats.
 Identities = 37/131 (28%), Positives = 58/131 (44%), Gaps = 27/131 (20%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNLGKDDNNLCNP--------RFNAHGDVNTIVCNSKDA 62
           ++ G  +R+RG V  +A  F +NL      LC+          FN   D + +V N+ + 
Sbjct: 18  VRVGNVMRIRGVVPDNAGRFFVNL------LCSEGPEAEYALHFNPRLDRSEVVFNTMEQ 71

Query: 63  GAWGAEQRESAFPFQPGSVVEVFNQTDLTIKLPDGYE--------FKFPNRLNLEAINYL 114
           G WG E+R    PFQ G   +V     L I   DG++        + F +R+    +  L
Sbjct: 72  GRWGREERGQGIPFQRGQPFDV-----LIITTEDGFKAVVGDSEYYHFRHRIPPANVRLL 126

Query: 115 SAGGDFKIKCV 125
             GGD ++  V
Sbjct: 127 EVGGDLQLDSV 137


>gb|ACI67584.1| Galectin-9 [Salmo salar]
          Length = 344

 Score = 53.1 bits (126), Expect = 8e-06,   Method: Composition-based stats.
 Identities = 38/127 (29%), Positives = 64/127 (50%), Gaps = 11/127 (8%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL------GKDDNNLCNPRFNAHGDVNTIVCNSKDAGA 64
           L+ G+ + + G V   A  F +NL      G D     NPR+++H     +V N+     
Sbjct: 24  LQEGKTIIITGRVPHGADRFHVNLQCGSMAGADIALHFNPRYDSHP--GYVVTNTLQQSK 81

Query: 65  WGAEQRESAFPFQPGS--VVEVFNQTDLTIKLPDGYEF-KFPNRLNLEAINYLSAGGDFK 121
           WG+E+R+   PFQ GS   +E+  Q D      +G  F  F +R+   +++ +SAGG  +
Sbjct: 82  WGSEERKQHSPFQHGSSFSLEITVQRDFFKLNVNGNHFMTFKHRIPFYSVDTISAGGKVE 141

Query: 122 IKCVAFE 128
           +  +AF+
Sbjct: 142 LTSIAFQ 148



 Score = 39.7 bits (91), Expect = 0.095,   Method: Composition-based stats.
 Identities = 26/74 (35%), Positives = 34/74 (45%), Gaps = 6/74 (8%)

Query: 8   NLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNLC--NPRFNAHGDVNTIVCNSKDAGAW 65
           N  L PG  + ++G V  +A  F +NL  +       NPRF    D   +V NSK    W
Sbjct: 223 NGGLYPGRTINIQGVVKPNANRFHVNLLFNSGIALHFNPRF----DETLVVRNSKLRDQW 278

Query: 66  GAEQRESAFPFQPG 79
           G E+R    PF  G
Sbjct: 279 GKEERSGGMPFHRG 292


>sp|P38486|LEG3_CANFA RecName: Full=Galectin-3; AltName: Full=Galactose-specific lectin
           3; AltName: Full=Mac-2 antigen; AltName:
           Full=IgE-binding protein; AltName: Full=35 kDa lectin;
           AltName: Full=Carbohydrate-binding protein 35; Short=CBP
           35; AltName: Full=Laminin-binding protein; AltName:
           Full=Lectin L-29
          Length = 296

 Score = 52.8 bits (125), Expect = 8e-06,   Method: Composition-based stats.
 Identities = 37/123 (30%), Positives = 62/123 (50%), Gaps = 7/123 (5%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAE 68
           +KP   + + G V   A    L+   G D     NPRFN   +   IVCN+K    WG E
Sbjct: 172 VKPRMLITILGTVRPSANRLALDFKRGNDVAFHFNPRFN-EDNKRVIVCNTKLDNIWGKE 230

Query: 69  QRESAFPFQPGS--VVEVFNQTD-LTIKLPDGYEFKFPNRL-NLEAINYLSAGGDFKIKC 124
           +R++AFPF+ G    ++V  ++D   + + D +  ++ +R+ NL  I+ L   GD  +  
Sbjct: 231 ERQAAFPFESGKPFKIQVLVESDHFKVAVNDAHLLQYNHRMKNLPEISKLGISGDIDLTS 290

Query: 125 VAF 127
            ++
Sbjct: 291 ASY 293


>ref|NP_001022189.1| gaLECtin family member (lec-2) [Caenorhabditis elegans]
 dbj|BAB11968.1| galectin LEC-2 [Caenorhabditis elegans]
 emb|CAC70097.1| C. elegans protein F52H3.7b, confirmed by transcript evidence
           [Caenorhabditis elegans]
          Length = 278

 Score = 52.8 bits (125), Expect = 9e-06,   Method: Composition-based stats.
 Identities = 39/115 (33%), Positives = 57/115 (49%), Gaps = 4/115 (3%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNLGKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAEQR 70
           L PG+ L V G     AK F +NL K + ++     NA  D   +V NS    AWG E+R
Sbjct: 159 LAPGKTLTVFGIPEKKAKRFHINLLKKNGDIA-LHLNARFDEKHVVRNSLINSAWGNEER 217

Query: 71  ESAFPFQP--GSVVEVFNQTDLTIKLPDGYEF-KFPNRLNLEAINYLSAGGDFKI 122
           E   PF+   G  +E+ N+        +G  F  + +RL+ + +N L  GGD +I
Sbjct: 218 EGKMPFEKAVGFDLEIHNEPYAFAVTVNGERFASYAHRLSPDEVNGLQIGGDVEI 272



 Score = 38.5 bits (88), Expect = 0.19,   Method: Composition-based stats.
 Identities = 27/116 (23%), Positives = 54/116 (46%), Gaps = 8/116 (6%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNLGKDDNNLCNPRFNAHGDVN----TIVCNSKDAGAWG 66
            +PG+ L V+G+   D+  F +NL  +  +        H  V      +V N+   G WG
Sbjct: 19  FEPGQTLIVKGKTGEDSIRFTVNLHTNTADFSGNDVPLHVSVRFDEGKLVFNTFSKGEWG 78

Query: 67  AEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGD 119
            E+R+S  P++ G  +++    + +   I +      ++ +R+ L +I + +  GD
Sbjct: 79  KEERKSN-PYKKGDDIDIRIRAHDSKFQIFVDQKEVKEYEHRVPLSSITHFTIDGD 133


>ref|XP_001507412.1| PREDICTED: similar to promyelocytic leukemia zinc finger protein;
           kruppel-like zinc finger protein; PLZF [Ornithorhynchus
           anatinus]
          Length = 266

 Score = 52.8 bits (125), Expect = 9e-06,   Method: Composition-based stats.
 Identities = 38/120 (31%), Positives = 59/120 (49%), Gaps = 8/120 (6%)

Query: 13  PGECLRVRGEVAADAKSFLLNLGKDDNNLC---NPRFNAHGDVNTIVCNSKDAGAWGAEQ 69
           P   + + G V   A    L+  K  N++    NPRFN   +   IVCNSK    WG E+
Sbjct: 143 PRTMITIVGTVNPQANRLALDFKKGPNDVVFHFNPRFN-EDNKRVIVCNSKLDNNWGREE 201

Query: 70  RESAFPFQPGS--VVEVFNQTD-LTIKLPDGYEFKFPNRL-NLEAINYLSAGGDFKIKCV 125
           R+S FPF+ G    + V  +TD   + + D +  ++ +R+ +L  I  L+  GD  +  V
Sbjct: 202 RQSTFPFEAGKPFKIMVLCETDHFKVAVNDAHLLQYNHRMRDLNQITGLAISGDITLTSV 261


>ref|XP_001497400.2| PREDICTED: similar to Galectin-4 (Lactose-binding lectin 4) (L-36
           lactose-binding protein) (L36LBP) (Antigen NY-CO-27)
           isoform 1 [Equus caballus]
          Length = 324

 Score = 52.8 bits (125), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 35/131 (26%), Positives = 63/131 (48%), Gaps = 22/131 (16%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL------GKDDNNLCNPRFNAHGDVNTIVCNSKDAGA 64
           L  G  + ++G  +   K F +N       G D     NPRF+    ++ +V NS+  G 
Sbjct: 27  LSVGMSVYIQGVPSEHMKRFFVNFAVGQSPGSDIAFHFNPRFDG---LDKVVFNSQQGGH 83

Query: 65  WGAEQRESAFPFQPGSVVEVFNQTDLTIKLPDGYE--------FKFPNRLNLEAINYLSA 116
           WG E+R+   PF+ G   E+     + + LP+ Y+        ++F +RL L+ + +L  
Sbjct: 84  WGKEERKREMPFRKGCPFEL-----VFMILPEHYKVVVNGNSFYEFGHRLPLQMVTHLQV 138

Query: 117 GGDFKIKCVAF 127
            GD +++ + F
Sbjct: 139 DGDVQLQSINF 149



 Score = 33.1 bits (74), Expect = 7.9,   Method: Composition-based stats.
 Identities = 31/120 (25%), Positives = 53/120 (44%), Gaps = 5/120 (4%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNLGKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAEQR 70
           L P   + ++G V   +KSF++N     +       N       +V NS   G+WG+E+R
Sbjct: 203 LTPRRTIIIKGFVPPSSKSFVINFKVGSSGDVALHMNPRLSEGIVVRNSFLNGSWGSEER 262

Query: 71  ESAF-PFQPGSVVEVFNQ--TDLTIKLPDG-YEFKFPNRL-NLEAINYLSAGGDFKIKCV 125
                PF+ G   ++  +  TD      +G + F F +RL   + ++ L   GD  +  V
Sbjct: 263 RIPHNPFRAGQYFDLSIRCGTDRFKVFANGQHLFDFSHRLPAFQRVDVLEIQGDVTLSYV 322


>dbj|BAD93151.1| Galectin-8 variant [Homo sapiens]
          Length = 338

 Score = 52.8 bits (125), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 39/124 (31%), Positives = 61/124 (49%), Gaps = 13/124 (10%)

Query: 8   NLNLKPGECLRVRGEVAADAKSFLLNL----GKDDNNLCNPRFNAHGDVNTIVCNSKDAG 63
           N  + PG  + V+GEV A+AKSF ++L     KD     NPR N    +   V NS    
Sbjct: 213 NTPMGPGRTVVVKGEVNANAKSFNVDLLAGKSKDIALHLNPRLN----IKAFVRNSFLQE 268

Query: 64  AWGAEQRE-SAFPFQPGSVVEVFNQTDL---TIKLPDGYEFKFPNRLN-LEAINYLSAGG 118
           +WG E+R  ++FPF PG   E+    D+    + +   +  ++ +R   L +I+ L   G
Sbjct: 269 SWGEEERNITSFPFSPGMYFEMIIYCDVREFKVAVNGVHSLEYKHRFKELSSIDTLEING 328

Query: 119 DFKI 122
           D  +
Sbjct: 329 DIHL 332


>gb|AAD45404.1| Po66 carbohydrate binding protein 2 [Homo sapiens]
          Length = 359

 Score = 52.4 bits (124), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 39/124 (31%), Positives = 61/124 (49%), Gaps = 13/124 (10%)

Query: 8   NLNLKPGECLRVRGEVAADAKSFLLNL----GKDDNNLCNPRFNAHGDVNTIVCNSKDAG 63
           N  + PG  + V+GEV A+AKSF ++L     KD     NPR N    +   V NS    
Sbjct: 234 NTPMGPGRTVVVKGEVNANAKSFNVDLLAGKSKDIALHLNPRLN----IKAFVRNSFLQE 289

Query: 64  AWGAEQRE-SAFPFQPGSVVEVFNQTDL---TIKLPDGYEFKFPNRLN-LEAINYLSAGG 118
           +WG E+R  ++FPF PG   E+    D+    + +   +  ++ +R   L +I+ L   G
Sbjct: 290 SWGEEERNITSFPFSPGMYFEMIIYCDVREFKVAVNGVHSLEYKHRFKELSSIDTLEING 349

Query: 119 DFKI 122
           D  +
Sbjct: 350 DIHL 353


>ref|XP_001157677.1| PREDICTED: similar to Galectin-8 variant isoform 2 [Pan
           troglodytes]
 ref|XP_001157824.1| PREDICTED: similar to Galectin-8 variant isoform 4 [Pan
           troglodytes]
 ref|XP_001157876.1| PREDICTED: similar to Galectin-8 variant isoform 5 [Pan
           troglodytes]
 ref|XP_001157928.1| PREDICTED: similar to Galectin-8 variant isoform 6 [Pan
           troglodytes]
 ref|XP_001157982.1| PREDICTED: similar to Galectin-8 variant isoform 7 [Pan
           troglodytes]
 ref|XP_001158208.1| PREDICTED: similar to Galectin-8 variant isoform 11 [Pan
           troglodytes]
 ref|XP_001158258.1| PREDICTED: similar to Galectin-8 variant isoform 12 [Pan
           troglodytes]
 ref|XP_001158311.1| PREDICTED: similar to Galectin-8 variant isoform 13 [Pan
           troglodytes]
 ref|XP_001158423.1| PREDICTED: similar to Galectin-8 variant isoform 15 [Pan
           troglodytes]
          Length = 317

 Score = 52.4 bits (124), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 39/124 (31%), Positives = 61/124 (49%), Gaps = 13/124 (10%)

Query: 8   NLNLKPGECLRVRGEVAADAKSFLLNL----GKDDNNLCNPRFNAHGDVNTIVCNSKDAG 63
           N  + PG  + V+GEV A+AKSF ++L     KD     NPR N    +   V NS    
Sbjct: 192 NTPMGPGRTVVVKGEVNANAKSFNVDLLAGKSKDIALHLNPRLN----IKAFVRNSFLQE 247

Query: 64  AWGAEQRE-SAFPFQPGSVVEVFNQTDL---TIKLPDGYEFKFPNRLN-LEAINYLSAGG 118
           +WG E+R  ++FPF PG   E+    D+    + +   +  ++ +R   L +I+ L   G
Sbjct: 248 SWGEEERNITSFPFSPGMYFEMIIYCDVREFKVAVNGVHSLEYKHRFKELSSIDTLEING 307

Query: 119 DFKI 122
           D  +
Sbjct: 308 DIHL 311



 Score = 38.9 bits (89), Expect = 0.13,   Method: Composition-based stats.
 Identities = 33/128 (25%), Positives = 51/128 (39%), Gaps = 14/128 (10%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNLGK--------DDNNLCNPRFNAHGDVNTIVCNSKDA 62
           L PG  + +RG V +DA  F ++L          D     NPRF   G    IVCN+   
Sbjct: 27  LDPGSLIVIRGHVPSDADRFQVDLQNGSSVKPRADVAFHFNPRFKRAG---CIVCNTLIN 83

Query: 63  GAWGAEQRESAFPFQPGSVVEVFN---QTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGD 119
             WG E+     PF+     E+     +    + +   +   + +R+  E I+ L   G 
Sbjct: 84  EKWGREEITYDTPFKREKSFEIVIMVLKDKFQVAVNGKHTLLYGHRIGPEKIDTLGIYGK 143

Query: 120 FKIKCVAF 127
             I  + F
Sbjct: 144 VNIHSIGF 151


>gb|EAW70055.1| lectin, galactoside-binding, soluble, 8 (galectin 8), isoform CRA_b
           [Homo sapiens]
 gb|EAW70056.1| lectin, galactoside-binding, soluble, 8 (galectin 8), isoform CRA_b
           [Homo sapiens]
          Length = 317

 Score = 52.4 bits (124), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 39/124 (31%), Positives = 61/124 (49%), Gaps = 13/124 (10%)

Query: 8   NLNLKPGECLRVRGEVAADAKSFLLNL----GKDDNNLCNPRFNAHGDVNTIVCNSKDAG 63
           N  + PG  + V+GEV A+AKSF ++L     KD     NPR N    +   V NS    
Sbjct: 192 NTPMGPGRTVVVKGEVNANAKSFNVDLLAGKSKDIALHLNPRLN----IKAFVRNSFLQE 247

Query: 64  AWGAEQRE-SAFPFQPGSVVEVFNQTDL---TIKLPDGYEFKFPNRLN-LEAINYLSAGG 118
           +WG E+R  ++FPF PG   E+    D+    + +   +  ++ +R   L +I+ L   G
Sbjct: 248 SWGEEERNITSFPFSPGMYFEMIIYCDVREFKVAVNGVHSLEYKHRFKELSSIDTLEING 307

Query: 119 DFKI 122
           D  +
Sbjct: 308 DIHL 311



 Score = 38.9 bits (89), Expect = 0.16,   Method: Composition-based stats.
 Identities = 33/128 (25%), Positives = 51/128 (39%), Gaps = 14/128 (10%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNLGK--------DDNNLCNPRFNAHGDVNTIVCNSKDA 62
           L PG  + +RG V +DA  F ++L          D     NPRF   G    IVCN+   
Sbjct: 27  LDPGTLIVIRGHVPSDADRFQVDLQNGSSMKPRADVAFHFNPRFKRAG---CIVCNTLIN 83

Query: 63  GAWGAEQRESAFPFQPGSVVEVFN---QTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGD 119
             WG E+     PF+     E+     +    + +   +   + +R+  E I+ L   G 
Sbjct: 84  EKWGREEITYDTPFKREKSFEIVIMVLKDKFQVAVNGKHTLLYGHRIGPEKIDTLGIYGK 143

Query: 120 FKIKCVAF 127
             I  + F
Sbjct: 144 VNIHSIGF 151


>gb|EAW70053.1| lectin, galactoside-binding, soluble, 8 (galectin 8), isoform CRA_a
           [Homo sapiens]
 gb|EAW70054.1| lectin, galactoside-binding, soluble, 8 (galectin 8), isoform CRA_a
           [Homo sapiens]
          Length = 359

 Score = 52.4 bits (124), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 39/124 (31%), Positives = 61/124 (49%), Gaps = 13/124 (10%)

Query: 8   NLNLKPGECLRVRGEVAADAKSFLLNL----GKDDNNLCNPRFNAHGDVNTIVCNSKDAG 63
           N  + PG  + V+GEV A+AKSF ++L     KD     NPR N    +   V NS    
Sbjct: 234 NTPMGPGRTVVVKGEVNANAKSFNVDLLAGKSKDIALHLNPRLN----IKAFVRNSFLQE 289

Query: 64  AWGAEQRE-SAFPFQPGSVVEVFNQTDL---TIKLPDGYEFKFPNRLN-LEAINYLSAGG 118
           +WG E+R  ++FPF PG   E+    D+    + +   +  ++ +R   L +I+ L   G
Sbjct: 290 SWGEEERNITSFPFSPGMYFEMIIYCDVREFKVAVNGVHSLEYKHRFKELSSIDTLEING 349

Query: 119 DFKI 122
           D  +
Sbjct: 350 DIHL 353



 Score = 38.9 bits (89), Expect = 0.15,   Method: Composition-based stats.
 Identities = 33/128 (25%), Positives = 51/128 (39%), Gaps = 14/128 (10%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNLGK--------DDNNLCNPRFNAHGDVNTIVCNSKDA 62
           L PG  + +RG V +DA  F ++L          D     NPRF   G    IVCN+   
Sbjct: 27  LDPGTLIVIRGHVPSDADRFQVDLQNGSSMKPRADVAFHFNPRFKRAG---CIVCNTLIN 83

Query: 63  GAWGAEQRESAFPFQPGSVVEVFN---QTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGD 119
             WG E+     PF+     E+     +    + +   +   + +R+  E I+ L   G 
Sbjct: 84  EKWGREEITYDTPFKREKSFEIVIMVLKDKFQVAVNGKHTLLYGHRIGPEKIDTLGIYGK 143

Query: 120 FKIKCVAF 127
             I  + F
Sbjct: 144 VNIHSIGF 151


>ref|NP_006490.3| galectin-8 isoform a [Homo sapiens]
 ref|NP_963839.1| galectin-8 isoform a [Homo sapiens]
 emb|CAI13773.1| lectin, galactoside-binding, soluble, 8 [Homo sapiens]
          Length = 359

 Score = 52.4 bits (124), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 39/124 (31%), Positives = 61/124 (49%), Gaps = 13/124 (10%)

Query: 8   NLNLKPGECLRVRGEVAADAKSFLLNL----GKDDNNLCNPRFNAHGDVNTIVCNSKDAG 63
           N  + PG  + V+GEV A+AKSF ++L     KD     NPR N    +   V NS    
Sbjct: 234 NTPMGPGRTVVVKGEVNANAKSFNVDLLAGKSKDIALHLNPRLN----IKAFVRNSFLQE 289

Query: 64  AWGAEQRE-SAFPFQPGSVVEVFNQTDL---TIKLPDGYEFKFPNRLN-LEAINYLSAGG 118
           +WG E+R  ++FPF PG   E+    D+    + +   +  ++ +R   L +I+ L   G
Sbjct: 290 SWGEEERNITSFPFSPGMYFEMIIYCDVREFKVAVNGVHSLEYKHRFKELSSIDTLEING 349

Query: 119 DFKI 122
           D  +
Sbjct: 350 DIHL 353



 Score = 38.9 bits (89), Expect = 0.16,   Method: Composition-based stats.
 Identities = 33/128 (25%), Positives = 51/128 (39%), Gaps = 14/128 (10%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNLGK--------DDNNLCNPRFNAHGDVNTIVCNSKDA 62
           L PG  + +RG V +DA  F ++L          D     NPRF   G    IVCN+   
Sbjct: 27  LDPGTLIVIRGHVPSDADRFQVDLQNGSSMKPRADVAFHFNPRFKRAG---CIVCNTLIN 83

Query: 63  GAWGAEQRESAFPFQPGSVVEVFN---QTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGD 119
             WG E+     PF+     E+     +    + +   +   + +R+  E I+ L   G 
Sbjct: 84  EKWGREEITYDTPFKREKSFEIVIMVLKDKFQVAVNGKHTLLYGHRIGPEKIDTLGIYGK 143

Query: 120 FKIKCVAF 127
             I  + F
Sbjct: 144 VNIHSIGF 151


>ref|NP_963837.1| galectin-8 isoform b [Homo sapiens]
 ref|NP_963838.1| galectin-8 isoform b [Homo sapiens]
 gb|AAK16735.1|AF342815_1 colorectal carcinoma-derived galectin-8 variant I [Homo sapiens]
 emb|CAI13774.1| lectin, galactoside-binding, soluble, 8 [Homo sapiens]
          Length = 317

 Score = 52.4 bits (124), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 39/124 (31%), Positives = 61/124 (49%), Gaps = 13/124 (10%)

Query: 8   NLNLKPGECLRVRGEVAADAKSFLLNL----GKDDNNLCNPRFNAHGDVNTIVCNSKDAG 63
           N  + PG  + V+GEV A+AKSF ++L     KD     NPR N    +   V NS    
Sbjct: 192 NTPMGPGRTVVVKGEVNANAKSFNVDLLAGKSKDIALHLNPRLN----IKAFVRNSFLQE 247

Query: 64  AWGAEQRE-SAFPFQPGSVVEVFNQTDL---TIKLPDGYEFKFPNRLN-LEAINYLSAGG 118
           +WG E+R  ++FPF PG   E+    D+    + +   +  ++ +R   L +I+ L   G
Sbjct: 248 SWGEEERNITSFPFSPGMYFEMIIYCDVREFKVAVNGVHSLEYKHRFKELSSIDTLEING 307

Query: 119 DFKI 122
           D  +
Sbjct: 308 DIHL 311



 Score = 38.5 bits (88), Expect = 0.17,   Method: Composition-based stats.
 Identities = 33/128 (25%), Positives = 51/128 (39%), Gaps = 14/128 (10%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNLGK--------DDNNLCNPRFNAHGDVNTIVCNSKDA 62
           L PG  + +RG V +DA  F ++L          D     NPRF   G    IVCN+   
Sbjct: 27  LDPGTLIVIRGHVPSDADRFQVDLQNGSSMKPRADVAFHFNPRFKRAG---CIVCNTLIN 83

Query: 63  GAWGAEQRESAFPFQPGSVVEVFN---QTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGD 119
             WG E+     PF+     E+     +    + +   +   + +R+  E I+ L   G 
Sbjct: 84  EKWGREEITYDTPFKREKSFEIVIMVLKDKFQVAVNGKHTLLYGHRIGPEKIDTLGIYGK 143

Query: 120 FKIKCVAF 127
             I  + F
Sbjct: 144 VNIHSIGF 151


>emb|CAA62904.1| Galectin-8 [Homo sapiens]
          Length = 318

 Score = 52.4 bits (124), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 39/124 (31%), Positives = 61/124 (49%), Gaps = 13/124 (10%)

Query: 8   NLNLKPGECLRVRGEVAADAKSFLLNL----GKDDNNLCNPRFNAHGDVNTIVCNSKDAG 63
           N  + PG  + V+GEV A+AKSF ++L     KD     NPR N    +   V NS    
Sbjct: 193 NTPMGPGRTVVVKGEVNANAKSFNVDLLAGKSKDIALHLNPRLN----IKAFVRNSFLQE 248

Query: 64  AWGAEQRE-SAFPFQPGSVVEVFNQTDL---TIKLPDGYEFKFPNRLN-LEAINYLSAGG 118
           +WG E+R  ++FPF PG   E+    D+    + +   +  ++ +R   L +I+ L   G
Sbjct: 249 SWGEEERNITSFPFSPGMYFEMIIYCDVREFKVAVNGVHSLEYKHRFKELSSIDTLEING 308

Query: 119 DFKI 122
           D  +
Sbjct: 309 DIHL 312



 Score = 40.0 bits (92), Expect = 0.056,   Method: Composition-based stats.
 Identities = 34/129 (26%), Positives = 52/129 (40%), Gaps = 15/129 (11%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNLGK--------DDNNLCNPRFNAHGDVNTIVCNSKDA 62
           L PG  + +RG V +DA  F ++L          D     NPRF   G    IVCN+   
Sbjct: 27  LDPGTLIVIRGHVPSDADRFQVDLQNGSSMKPRADVAFHFNPRFKRAG---CIVCNTLIN 83

Query: 63  GAWGAEQRESAFPFQPG----SVVEVFNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGG 118
             WG E+     PFQ       +V +  +    + +   +   + +R+  E I+ L   G
Sbjct: 84  EKWGREEITYDTPFQKEKKSFEIVIMVLKAKFQVAVNGKHTLLYGHRIGPEKIDTLGIYG 143

Query: 119 DFKIKCVAF 127
              I  + F
Sbjct: 144 KVNIHSIGF 152


>ref|XP_001157611.1| PREDICTED: galectin 8 isoform 1 [Pan troglodytes]
 ref|XP_001157731.1| PREDICTED: galectin 8 isoform 3 [Pan troglodytes]
 ref|XP_001158151.1| PREDICTED: galectin 8 isoform 10 [Pan troglodytes]
 ref|XP_001158371.1| PREDICTED: galectin 8 isoform 14 [Pan troglodytes]
          Length = 359

 Score = 52.4 bits (124), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 39/124 (31%), Positives = 61/124 (49%), Gaps = 13/124 (10%)

Query: 8   NLNLKPGECLRVRGEVAADAKSFLLNL----GKDDNNLCNPRFNAHGDVNTIVCNSKDAG 63
           N  + PG  + V+GEV A+AKSF ++L     KD     NPR N    +   V NS    
Sbjct: 234 NTPMGPGRTVVVKGEVNANAKSFNVDLLAGKSKDIALHLNPRLN----IKAFVRNSFLQE 289

Query: 64  AWGAEQRE-SAFPFQPGSVVEVFNQTDL---TIKLPDGYEFKFPNRLN-LEAINYLSAGG 118
           +WG E+R  ++FPF PG   E+    D+    + +   +  ++ +R   L +I+ L   G
Sbjct: 290 SWGEEERNITSFPFSPGMYFEMIIYCDVREFKVAVNGVHSLEYKHRFKELSSIDTLEING 349

Query: 119 DFKI 122
           D  +
Sbjct: 350 DIHL 353



 Score = 38.9 bits (89), Expect = 0.14,   Method: Composition-based stats.
 Identities = 33/128 (25%), Positives = 51/128 (39%), Gaps = 14/128 (10%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNLGK--------DDNNLCNPRFNAHGDVNTIVCNSKDA 62
           L PG  + +RG V +DA  F ++L          D     NPRF   G    IVCN+   
Sbjct: 27  LDPGSLIVIRGHVPSDADRFQVDLQNGSSVKPRADVAFHFNPRFKRAG---CIVCNTLIN 83

Query: 63  GAWGAEQRESAFPFQPGSVVEVFN---QTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGD 119
             WG E+     PF+     E+     +    + +   +   + +R+  E I+ L   G 
Sbjct: 84  EKWGREEITYDTPFKREKSFEIVIMVLKDKFQVAVNGKHTLLYGHRIGPEKIDTLGIYGK 143

Query: 120 FKIKCVAF 127
             I  + F
Sbjct: 144 VNIHSIGF 151


>sp|O00214|LEG8_HUMAN RecName: Full=Galectin-8; Short=Gal-8; AltName: Full=Prostate
           carcinoma tumor antigen 1; Short=PCTA-1; AltName:
           Full=Po66 carbohydrate-binding protein; Short=Po66-CBP
 gb|AAH16486.2| Lectin, galactoside-binding, soluble, 8 [Homo sapiens]
          Length = 316

 Score = 52.4 bits (124), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 39/124 (31%), Positives = 61/124 (49%), Gaps = 13/124 (10%)

Query: 8   NLNLKPGECLRVRGEVAADAKSFLLNL----GKDDNNLCNPRFNAHGDVNTIVCNSKDAG 63
           N  + PG  + V+GEV A+AKSF ++L     KD     NPR N    +   V NS    
Sbjct: 191 NTPMGPGRTVVVKGEVNANAKSFNVDLLAGKSKDIALHLNPRLN----IKAFVRNSFLQE 246

Query: 64  AWGAEQRE-SAFPFQPGSVVEVFNQTDL---TIKLPDGYEFKFPNRLN-LEAINYLSAGG 118
           +WG E+R  ++FPF PG   E+    D+    + +   +  ++ +R   L +I+ L   G
Sbjct: 247 SWGEEERNITSFPFSPGMYFEMIIYCDVREFKVAVNGVHSLEYKHRFKELSSIDTLEING 306

Query: 119 DFKI 122
           D  +
Sbjct: 307 DIHL 310



 Score = 38.5 bits (88), Expect = 0.18,   Method: Composition-based stats.
 Identities = 33/128 (25%), Positives = 51/128 (39%), Gaps = 14/128 (10%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNLGK--------DDNNLCNPRFNAHGDVNTIVCNSKDA 62
           L PG  + +RG V +DA  F ++L          D     NPRF   G    IVCN+   
Sbjct: 26  LDPGTLIVIRGHVPSDADRFQVDLQNGSSMKPRADVAFHFNPRFKRAG---CIVCNTLIN 82

Query: 63  GAWGAEQRESAFPFQPGSVVEVFN---QTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGD 119
             WG E+     PF+     E+     +    + +   +   + +R+  E I+ L   G 
Sbjct: 83  EKWGREEITYDTPFKREKSFEIVIMVLKDKFQVAVNGKHTLLYGHRIGPEKIDTLGIYGK 142

Query: 120 FKIKCVAF 127
             I  + F
Sbjct: 143 VNIHSIGF 150


>gb|AAD45403.1| Po66 carbohydrate binding protein 1 [Homo sapiens]
 gb|AAH15818.1| Lectin, galactoside-binding, soluble, 8 [Homo sapiens]
 gb|ABM87017.1| lectin, galactoside-binding, soluble, 8 (galectin 8) [synthetic
           construct]
 gb|ABW03852.1| lectin, galactoside-binding, soluble, 8 (galectin 8) [synthetic
           construct]
          Length = 358

 Score = 52.4 bits (124), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 39/124 (31%), Positives = 61/124 (49%), Gaps = 13/124 (10%)

Query: 8   NLNLKPGECLRVRGEVAADAKSFLLNL----GKDDNNLCNPRFNAHGDVNTIVCNSKDAG 63
           N  + PG  + V+GEV A+AKSF ++L     KD     NPR N    +   V NS    
Sbjct: 233 NTPMGPGRTVVVKGEVNANAKSFNVDLLAGKSKDIALHLNPRLN----IKAFVRNSFLQE 288

Query: 64  AWGAEQRE-SAFPFQPGSVVEVFNQTDL---TIKLPDGYEFKFPNRLN-LEAINYLSAGG 118
           +WG E+R  ++FPF PG   E+    D+    + +   +  ++ +R   L +I+ L   G
Sbjct: 289 SWGEEERNITSFPFSPGMYFEMIIYCDVREFKVAVNGVHSLEYKHRFKELSSIDTLEING 348

Query: 119 DFKI 122
           D  +
Sbjct: 349 DIHL 352


>gb|AAF19370.1| galectin-8 [Homo sapiens]
 dbj|BAG73177.1| galactoside-binding soluble 8 lectin [synthetic construct]
          Length = 317

 Score = 52.4 bits (124), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 39/124 (31%), Positives = 61/124 (49%), Gaps = 13/124 (10%)

Query: 8   NLNLKPGECLRVRGEVAADAKSFLLNL----GKDDNNLCNPRFNAHGDVNTIVCNSKDAG 63
           N  + PG  + V+GEV A+AKSF ++L     KD     NPR N    +   V NS    
Sbjct: 192 NTPMGPGRTVVVKGEVNANAKSFNVDLLAGKSKDIALHLNPRLN----IKAFVRNSFLQE 247

Query: 64  AWGAEQRE-SAFPFQPGSVVEVFNQTDL---TIKLPDGYEFKFPNRLN-LEAINYLSAGG 118
           +WG E+R  ++FPF PG   E+    D+    + +   +  ++ +R   L +I+ L   G
Sbjct: 248 SWGEEERNITSFPFSPGMYFEMIIYCDVREFKVAVNGVHSLEYKHRFKELSSIDTLEING 307

Query: 119 DFKI 122
           D  +
Sbjct: 308 DIHL 311


>ref|NP_001011449.1| lectin, galactoside-binding, soluble, 4 (galectin 4) [Xenopus
           (Silurana) tropicalis]
 gb|AAH88541.1| Lectin, galactoside-binding, soluble, 4 (galectin 4) [Xenopus
           tropicalis]
          Length = 327

 Score = 52.4 bits (124), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 34/123 (27%), Positives = 60/123 (48%), Gaps = 13/123 (10%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL------GKDDNNLCNPRFNAHGDVNTIVCNSKDAGA 64
           L+ G  + ++G +      F +N       G D     NPRF+     + +V NS   G+
Sbjct: 27  LRAGMSVYIQGTIPNHITRFAVNFTCGQFDGSDIACHFNPRFDGK---DKVVFNSLIGGS 83

Query: 65  WGAEQRES-AFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDF 120
           WG+E+++  +FPF+ G   ++    NQ+   I +     +KF +R+ LE +N L   GD 
Sbjct: 84  WGSEEKKKDSFPFRKGKSFDLAFMINQSAFEITVNGSSFYKFKHRMPLERVNSLQVSGDV 143

Query: 121 KIK 123
            ++
Sbjct: 144 TVQ 146



 Score = 44.3 bits (103), Expect = 0.004,   Method: Composition-based stats.
 Identities = 22/75 (29%), Positives = 39/75 (52%), Gaps = 1/75 (1%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNLGKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAEQR 70
           + P + + +RG +   A+ F +N     +N     FN     N +V NS+  G+WG E+R
Sbjct: 206 MSPRKTVIIRGFIPEGAERFHINFKAGSSNDVALHFNPRLTENVVVRNSRLGGSWGQEER 265

Query: 71  ESAF-PFQPGSVVEV 84
             ++ PF+PG   ++
Sbjct: 266 NLSYNPFRPGQYFDI 280


>gb|AAD45402.1| Po66 carbohydrate binding protein [Homo sapiens]
          Length = 316

 Score = 52.0 bits (123), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 39/124 (31%), Positives = 61/124 (49%), Gaps = 13/124 (10%)

Query: 8   NLNLKPGECLRVRGEVAADAKSFLLNL----GKDDNNLCNPRFNAHGDVNTIVCNSKDAG 63
           N  + PG  + V+GEV A+AKSF ++L     KD     NPR N    +   V NS    
Sbjct: 191 NTPMGPGRTVVVKGEVNANAKSFNVDLLAGKSKDIALHLNPRLN----IKAFVRNSFLQE 246

Query: 64  AWGAEQRE-SAFPFQPGSVVEVFNQTDL---TIKLPDGYEFKFPNRLN-LEAINYLSAGG 118
           +WG E+R  ++FPF PG   E+    D+    + +   +  ++ +R   L +I+ L   G
Sbjct: 247 SWGEEERNITSFPFSPGMYFEMIIYCDVREFKVAVNGVHSLEYKHRFKELSSIDTLEING 306

Query: 119 DFKI 122
           D  +
Sbjct: 307 DIHL 310


>ref|NP_001134305.1| Galectin-3 [Salmo salar]
 gb|ACI66985.1| Galectin-3 [Salmo salar]
 gb|ACN10264.1| Galectin-3 [Salmo salar]
 gb|ACN12620.1| Galectin-3 [Salmo salar]
          Length = 271

 Score = 52.0 bits (123), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 41/133 (30%), Positives = 66/133 (49%), Gaps = 14/133 (10%)

Query: 8   NLNLKPGEC-----LRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVCNSK 60
           +LNL P  C     + +RG +  +AK F +NL  G D     NPRFN  G   TIV NS+
Sbjct: 139 DLNL-PNGCYDKMLITIRGTINQNAKMFTINLTKGNDIAMHVNPRFNDQGK-KTIVRNSQ 196

Query: 61  DAGAWGAEQRE-SAFPF---QPGSVVEVFNQTDLTIKLPDGYEFKFPNRL-NLEAINYLS 115
               WG E+RE + FPF   QP  +  +   ++  + +   +  +F +R+ ++ +I +L 
Sbjct: 197 IGNTWGKEEREHNHFPFIQGQPFEMKIMCTNSEFKVAVNSSHILEFKHRIRDIHSIKHLG 256

Query: 116 AGGDFKIKCVAFE 128
              D  +  V  +
Sbjct: 257 IYNDVTLTSVEID 269


>ref|NP_496165.3| gaLECtin family member (lec-2) [Caenorhabditis elegans]
 emb|CAA91327.2| C. elegans protein F52H3.7a, confirmed by transcript evidence
            [Caenorhabditis elegans]
          Length = 1245

 Score = 52.0 bits (123), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 39/115 (33%), Positives = 57/115 (49%), Gaps = 4/115 (3%)

Query: 11   LKPGECLRVRGEVAADAKSFLLNLGKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAEQR 70
            L PG+ L V G     AK F +NL K + ++     NA  D   +V NS    AWG E+R
Sbjct: 1126 LAPGKTLTVFGIPEKKAKRFHINLLKKNGDIA-LHLNARFDEKHVVRNSLINSAWGNEER 1184

Query: 71   ESAFPFQP--GSVVEVFNQTDLTIKLPDGYEF-KFPNRLNLEAINYLSAGGDFKI 122
            E   PF+   G  +E+ N+        +G  F  + +RL+ + +N L  GGD +I
Sbjct: 1185 EGKMPFEKAVGFDLEIHNEPYAFAVTVNGERFASYAHRLSPDEVNGLQIGGDVEI 1239



 Score = 37.7 bits (86), Expect = 0.32,   Method: Composition-based stats.
 Identities = 27/116 (23%), Positives = 54/116 (46%), Gaps = 8/116 (6%)

Query: 11   LKPGECLRVRGEVAADAKSFLLNLGKDDNNLCNPRFNAHGDV----NTIVCNSKDAGAWG 66
             +PG+ L V+G+   D+  F +NL  +  +        H  V      +V N+   G WG
Sbjct: 986  FEPGQTLIVKGKTGEDSIRFTVNLHTNTADFSGNDVPLHVSVRFDEGKLVFNTFSKGEWG 1045

Query: 67   AEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGD 119
             E+R+S  P++ G  +++    + +   I +      ++ +R+ L +I + +  GD
Sbjct: 1046 KEERKSN-PYKKGDDIDIRIRAHDSKFQIFVDQKEVKEYEHRVPLSSITHFTIDGD 1100


>gb|EDL15598.1| lectin, galactose binding, soluble 9, isoform CRA_b [Mus musculus]
          Length = 231

 Score = 52.0 bits (123), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 31/126 (24%), Positives = 61/126 (48%), Gaps = 11/126 (8%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL-----GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAW 65
           L+ G  + ++G   + A+ F++N      G D     NPRF   G    +VCN+K  G W
Sbjct: 25  LQEGLQVTLQGTTKSFAQRFVVNFQNSFNGNDIAFHFNPRFEEGG---YVVCNTKQNGQW 81

Query: 66  GAEQRESAFPFQPGSVVE---VFNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFKI 122
           G E+R+   PFQ G   E   +  +++  + +   +  ++ +R+    ++ ++  G  K+
Sbjct: 82  GPEERKMQMPFQKGMPFELCFLVQRSEFKVMVNKKFFVQYQHRVPYHLVDTIAVSGCLKL 141

Query: 123 KCVAFE 128
             + F+
Sbjct: 142 SFITFQ 147


>gb|AAB51605.1| prostate carcinoma tumor antigen [Homo sapiens]
          Length = 316

 Score = 52.0 bits (123), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 39/124 (31%), Positives = 61/124 (49%), Gaps = 13/124 (10%)

Query: 8   NLNLKPGECLRVRGEVAADAKSFLLNL----GKDDNNLCNPRFNAHGDVNTIVCNSKDAG 63
           N  + PG  + V+GEV A+AKSF ++L     KD     NPR N    +   V NS    
Sbjct: 191 NTPMGPGRTVVVQGEVNANAKSFNVDLLAGKSKDIALHLNPRLN----IKAFVRNSFLQE 246

Query: 64  AWGAEQRE-SAFPFQPGSVVEVFNQTDL---TIKLPDGYEFKFPNRLN-LEAINYLSAGG 118
           +WG E+R  ++FPF PG   E+    D+    + +   +  ++ +R   L +I+ L   G
Sbjct: 247 SWGEEERNITSFPFSPGMYFEMIIYCDVREFKVAVNGVHSLEYKHRFKELSSIDTLEING 306

Query: 119 DFKI 122
           D  +
Sbjct: 307 DIHL 310



 Score = 38.5 bits (88), Expect = 0.18,   Method: Composition-based stats.
 Identities = 33/128 (25%), Positives = 51/128 (39%), Gaps = 14/128 (10%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNLGK--------DDNNLCNPRFNAHGDVNTIVCNSKDA 62
           L PG  + +RG V +DA  F ++L          D     NPRF   G    IVCN+   
Sbjct: 26  LDPGTLIVIRGHVPSDADRFQVDLQNGSSVKPRADVAFHFNPRFKRAG---CIVCNTLIN 82

Query: 63  GAWGAEQRESAFPFQPGSVVEVFN---QTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGD 119
             WG E+     PF+     E+     +    + +   +   + +R+  E I+ L   G 
Sbjct: 83  EKWGREEITYDTPFKREKSFEIVIMVLKDKFQVAVNGKHTLLYGHRIGPEKIDTLGIYGK 142

Query: 120 FKIKCVAF 127
             I  + F
Sbjct: 143 VNIHSIGF 150


>ref|XP_001158037.1| PREDICTED: similar to lymphocyte/NHL galectin-8 short isoform
           isoform 8 [Pan troglodytes]
          Length = 258

 Score = 51.6 bits (122), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 39/124 (31%), Positives = 61/124 (49%), Gaps = 13/124 (10%)

Query: 8   NLNLKPGECLRVRGEVAADAKSFLLNL----GKDDNNLCNPRFNAHGDVNTIVCNSKDAG 63
           N  + PG  + V+GEV A+AKSF ++L     KD     NPR N    +   V NS    
Sbjct: 133 NTPMGPGRTVVVKGEVNANAKSFNVDLLAGKSKDIALHLNPRLN----IKAFVRNSFLQE 188

Query: 64  AWGAEQRE-SAFPFQPGSVVEVFNQTDL---TIKLPDGYEFKFPNRLN-LEAINYLSAGG 118
           +WG E+R  ++FPF PG   E+    D+    + +   +  ++ +R   L +I+ L   G
Sbjct: 189 SWGEEERNITSFPFSPGMYFEMIIYCDVREFKVAVNGVHSLEYKHRFKELSSIDTLEING 248

Query: 119 DFKI 122
           D  +
Sbjct: 249 DIHL 252



 Score = 36.2 bits (82), Expect = 1.0,   Method: Composition-based stats.
 Identities = 26/82 (31%), Positives = 35/82 (42%), Gaps = 11/82 (13%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNLGK--------DDNNLCNPRFNAHGDVNTIVCNSKDA 62
           L PG  + +RG V +DA  F ++L          D     NPRF   G    IVCN+   
Sbjct: 27  LDPGSLIVIRGHVPSDADRFQVDLQNGSSVKPRADVAFHFNPRFKRAG---CIVCNTLIN 83

Query: 63  GAWGAEQRESAFPFQPGSVVEV 84
             WG E+     PF+     E+
Sbjct: 84  EKWGREEITYDTPFKREKSFEI 105


>ref|XP_001158092.1| PREDICTED: galectin 8 isoform 9 [Pan troglodytes]
          Length = 300

 Score = 51.6 bits (122), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 39/124 (31%), Positives = 61/124 (49%), Gaps = 13/124 (10%)

Query: 8   NLNLKPGECLRVRGEVAADAKSFLLNL----GKDDNNLCNPRFNAHGDVNTIVCNSKDAG 63
           N  + PG  + V+GEV A+AKSF ++L     KD     NPR N    +   V NS    
Sbjct: 175 NTPMGPGRTVVVKGEVNANAKSFNVDLLAGKSKDIALHLNPRLN----IKAFVRNSFLQE 230

Query: 64  AWGAEQRE-SAFPFQPGSVVEVFNQTDL---TIKLPDGYEFKFPNRLN-LEAINYLSAGG 118
           +WG E+R  ++FPF PG   E+    D+    + +   +  ++ +R   L +I+ L   G
Sbjct: 231 SWGEEERNITSFPFSPGMYFEMIIYCDVREFKVAVNGVHSLEYKHRFKELSSIDTLEING 290

Query: 119 DFKI 122
           D  +
Sbjct: 291 DIHL 294



 Score = 36.2 bits (82), Expect = 1.0,   Method: Composition-based stats.
 Identities = 26/82 (31%), Positives = 35/82 (42%), Gaps = 11/82 (13%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNLGK--------DDNNLCNPRFNAHGDVNTIVCNSKDA 62
           L PG  + +RG V +DA  F ++L          D     NPRF   G    IVCN+   
Sbjct: 27  LDPGSLIVIRGHVPSDADRFQVDLQNGSSVKPRADVAFHFNPRFKRAG---CIVCNTLIN 83

Query: 63  GAWGAEQRESAFPFQPGSVVEV 84
             WG E+     PF+     E+
Sbjct: 84  EKWGREEITYDTPFKREKSFEI 105


>ref|NP_001075807.1| lectin, galactoside-binding, soluble, 3 [Oryctolagus cuniculus]
 sp|P47845|LEG3_RABIT RecName: Full=Galectin-3; AltName: Full=Galactose-specific lectin
           3; AltName: Full=Mac-2 antigen; AltName:
           Full=IgE-binding protein; AltName: Full=35 kDa lectin;
           AltName: Full=Carbohydrate-binding protein 35; Short=CBP
           35; AltName: Full=Laminin-binding protein; AltName:
           Full=Lectin L-29
 gb|AAC48491.1| galectin-3
          Length = 242

 Score = 51.6 bits (122), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 36/116 (31%), Positives = 60/116 (51%), Gaps = 7/116 (6%)

Query: 13  PGECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAEQR 70
           P   + + G V  +A    L+   G D     NPRFN + +   IVCN+K    WG E+R
Sbjct: 120 PRMLITIVGTVKPNANRLALDFKRGNDVAFHFNPRFNEN-NRRVIVCNTKVDNNWGREER 178

Query: 71  ESAFPFQPGS--VVEVFNQTD-LTIKLPDGYEFKFPNRL-NLEAINYLSAGGDFKI 122
           ++ FPF+ G    ++V  + D   + + D +  ++ +R+ NL+ IN L   GD ++
Sbjct: 179 QTTFPFEIGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRMRNLKEINKLGISGDIQL 234


>gb|EDM06985.1| lectin, galactoside-binding, soluble 8, isoform CRA_a [Rattus
           norvegicus]
 gb|EDM06986.1| lectin, galactoside-binding, soluble 8, isoform CRA_a [Rattus
           norvegicus]
 gb|EDM06987.1| lectin, galactoside-binding, soluble 8, isoform CRA_a [Rattus
           norvegicus]
 gb|EDM06988.1| lectin, galactoside-binding, soluble 8, isoform CRA_a [Rattus
           norvegicus]
          Length = 223

 Score = 51.6 bits (122), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 38/124 (30%), Positives = 62/124 (50%), Gaps = 13/124 (10%)

Query: 8   NLNLKPGECLRVRGEVAADAKSFLLNL----GKDDNNLCNPRFNAHGDVNTIVCNSKDAG 63
           N ++ PG  + V+GEV  +AKSF ++L     +D     NPR N    V   V NS    
Sbjct: 98  NASMGPGRTVVVKGEVNTNAKSFNVDLVAGRSRDIALHLNPRLN----VKAFVRNSFLQD 153

Query: 64  AWGAEQRE-SAFPFQPGSVVEVFNQTDL---TIKLPDGYEFKFPNRL-NLEAINYLSAGG 118
           AWG E+R  + FPF  G   E+    D+    + +   +  ++ +R  +L +I+ L+  G
Sbjct: 154 AWGEEERNITCFPFSSGMYFEMIIYCDVREFKVAVNGVHSLEYKHRFKDLSSIDTLAVDG 213

Query: 119 DFKI 122
           D ++
Sbjct: 214 DIRL 217


>ref|XP_001492208.1| PREDICTED: similar to Lectin, galactoside-binding, soluble, 8
           (galectin 8) isoform 1 [Equus caballus]
          Length = 357

 Score = 51.6 bits (122), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 38/124 (30%), Positives = 61/124 (49%), Gaps = 13/124 (10%)

Query: 8   NLNLKPGECLRVRGEVAADAKSFLLNL----GKDDNNLCNPRFNAHGDVNTIVCNSKDAG 63
           N ++ PG  + V+GEV  +AKSF ++L     KD     NPR N    +   V NS    
Sbjct: 232 NSSMGPGRTIVVKGEVNTNAKSFNVDLKSGKSKDIALHLNPRLN----IKAFVRNSFLQE 287

Query: 64  AWGAEQRE-SAFPFQPGSVVEVFNQTDL---TIKLPDGYEFKFPNRLN-LEAINYLSAGG 118
           +WG E+R  ++FPF PG   E+    D+    + +   +  ++ +R   L +I+ L   G
Sbjct: 288 SWGEEERNITSFPFSPGMYFEMIIYCDVREFKVAVNGVHSLEYKHRFKELSSIDMLEIDG 347

Query: 119 DFKI 122
           D  +
Sbjct: 348 DIHL 351



 Score = 41.2 bits (95), Expect = 0.029,   Method: Composition-based stats.
 Identities = 34/128 (26%), Positives = 52/128 (40%), Gaps = 14/128 (10%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNLG--------KDDNNLCNPRFNAHGDVNTIVCNSKDA 62
           L+PG  + VRG V  D+  F ++L          D     NPRF      N IVCN+   
Sbjct: 26  LEPGTLIVVRGHVPNDSDRFQVDLQCGSSVKPRADVAFHFNPRFKRS---NCIVCNTLKN 82

Query: 63  GAWGAEQRESAFPFQPGSVVEVFN---QTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGD 119
             WG E+     PF+     E+     +    + +   +   + +R++ E I+ L   G 
Sbjct: 83  EKWGWEEITYDMPFKKERSFEIVFMVLKDKFQVAVNGKHILLYAHRISPEKIDTLGISGK 142

Query: 120 FKIKCVAF 127
             I  V F
Sbjct: 143 VNIHSVGF 150


>dbj|BAG58824.1| unnamed protein product [Homo sapiens]
          Length = 162

 Score = 51.6 bits (122), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 39/124 (31%), Positives = 61/124 (49%), Gaps = 13/124 (10%)

Query: 8   NLNLKPGECLRVRGEVAADAKSFLLNL----GKDDNNLCNPRFNAHGDVNTIVCNSKDAG 63
           N  + PG  + V+GEV A+AKSF ++L     KD     NPR N    +   V NS    
Sbjct: 37  NTPMGPGRTVVVKGEVNANAKSFNVDLLAGKSKDIALHLNPRLN----IKAFVRNSFLQE 92

Query: 64  AWGAEQRE-SAFPFQPGSVVEVFNQTDL---TIKLPDGYEFKFPNRLN-LEAINYLSAGG 118
           +WG E+R  ++FPF PG   E+    D+    + +   +  ++ +R   L +I+ L   G
Sbjct: 93  SWGEEERNITSFPFSPGMYFEMIIYCDVREFKVAVNGVHSLEYKHRFKELSSIDTLEING 152

Query: 119 DFKI 122
           D  +
Sbjct: 153 DIHL 156


>emb|CAI24051.1| lectin, galactose binding, soluble 9 [Mus musculus]
 emb|CAI25277.1| lectin, galactose binding, soluble 9 [Mus musculus]
          Length = 352

 Score = 51.6 bits (122), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 31/126 (24%), Positives = 61/126 (48%), Gaps = 11/126 (8%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL-----GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAW 65
           L+ G  + ++G   + A+ F++N      G D     NPRF   G    +VCN+K  G W
Sbjct: 25  LQEGLQVTLQGTTKSFAQRFVVNFQNSFNGNDIAFHFNPRFEEGG---YVVCNTKQNGQW 81

Query: 66  GAEQRESAFPFQPGSVVE---VFNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFKI 122
           G E+R+   PFQ G   E   +  +++  + +   +  ++ +R+    ++ ++  G  K+
Sbjct: 82  GPEERKMQMPFQKGMPFELCFLVQRSEFKVMVNKKFFVQYQHRVPYHLVDTIAVSGCLKL 141

Query: 123 KCVAFE 128
             + F+
Sbjct: 142 SFITFQ 147



 Score = 45.8 bits (107), Expect = 0.001,   Method: Composition-based stats.
 Identities = 37/123 (30%), Positives = 57/123 (46%), Gaps = 12/123 (9%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAE 68
           L P + + + G V  DA  F +NL  G D     NPRFN     N +V N++   +WG E
Sbjct: 232 LYPSKSIMISGNVLPDATRFHINLRCGGDIAFHLNPRFNE----NAVVRNTQINNSWGQE 287

Query: 69  QRE--SAFPFQPGSVVEVFNQTD---LTIKLPDGYEFKFPNRL-NLEAINYLSAGGDFKI 122
           +R      PF  G    V+   +     + +   +  ++ +RL NL+ IN L   GD ++
Sbjct: 288 ERSLLGRMPFSRGQSFSVWIICEGHCFKVAVNGQHMCEYYHRLKNLQDINTLEVAGDIQL 347

Query: 123 KCV 125
             V
Sbjct: 348 THV 350


>gb|AAH03754.1| Lgals9 protein [Mus musculus]
          Length = 322

 Score = 51.6 bits (122), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 31/126 (24%), Positives = 61/126 (48%), Gaps = 11/126 (8%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL-----GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAW 65
           L+ G  + ++G   + A+ F++N      G D     NPRF   G    +VCN+K  G W
Sbjct: 25  LQEGLQVTLQGTTKSFAQRFVVNFQNSFNGNDIAFHFNPRFEEGG---YVVCNTKQNGQW 81

Query: 66  GAEQRESAFPFQPGSVVE---VFNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFKI 122
           G E+R+   PFQ G   E   +  +++  + +   +  ++ +R+    ++ ++  G  K+
Sbjct: 82  GPEERKMQMPFQKGMPFELCFLVQRSEFKVMVNKKFFVQYQHRVPYHLVDTIAVSGCLKL 141

Query: 123 KCVAFE 128
             + F+
Sbjct: 142 SFITFQ 147



 Score = 45.8 bits (107), Expect = 0.001,   Method: Composition-based stats.
 Identities = 37/123 (30%), Positives = 57/123 (46%), Gaps = 12/123 (9%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAE 68
           L P + + + G V  DA  F +NL  G D     NPRFN     N +V N++   +WG E
Sbjct: 202 LYPSKSIMISGNVLPDATRFHINLRCGGDIAFHLNPRFNE----NAVVRNTQINNSWGQE 257

Query: 69  QRE--SAFPFQPGSVVEVFNQTD---LTIKLPDGYEFKFPNRL-NLEAINYLSAGGDFKI 122
           +R      PF  G    V+   +     + +   +  ++ +RL NL+ IN L   GD ++
Sbjct: 258 ERSLLGRMPFSRGQSFSVWIICEGHCFKVAVNGQHMCEYYHRLKNLQDINTLEVAGDIQL 317

Query: 123 KCV 125
             V
Sbjct: 318 THV 320


>sp|O08573|LEG9_MOUSE RecName: Full=Galectin-9
 gb|AAB51190.1| beta-galactoside binding lectin intestine isoform
          Length = 353

 Score = 51.6 bits (122), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 31/126 (24%), Positives = 61/126 (48%), Gaps = 11/126 (8%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL-----GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAW 65
           L+ G  + ++G   + A+ F++N      G D     NPRF   G    +VCN+K  G W
Sbjct: 25  LQEGLQVTLQGTTKSFAQRFVVNFQNSFNGNDIAFHFNPRFEEGG---YVVCNTKQNGQW 81

Query: 66  GAEQRESAFPFQPGSVVE---VFNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFKI 122
           G E+R+   PFQ G   E   +  +++  + +   +  ++ +R+    ++ ++  G  K+
Sbjct: 82  GPEERKMQMPFQKGMPFELCFLVQRSEFKVMVNKKFFVQYQHRVPYHLVDTIAVSGCLKL 141

Query: 123 KCVAFE 128
             + F+
Sbjct: 142 SFITFQ 147



 Score = 45.8 bits (107), Expect = 0.001,   Method: Composition-based stats.
 Identities = 37/123 (30%), Positives = 57/123 (46%), Gaps = 12/123 (9%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAE 68
           L P + + + G V  DA  F +NL  G D     NPRFN     N +V N++   +WG E
Sbjct: 233 LYPSKSIMISGNVLPDATRFHINLRCGGDIAFHLNPRFNE----NAVVRNTQINNSWGQE 288

Query: 69  QRE--SAFPFQPGSVVEVFNQTD---LTIKLPDGYEFKFPNRL-NLEAINYLSAGGDFKI 122
           +R      PF  G    V+   +     + +   +  ++ +RL NL+ IN L   GD ++
Sbjct: 289 ERSLLGRMPFSRGQSFSVWIICEGHCFKVAVNGQHMCEYYHRLKNLQDINTLEVAGDIQL 348

Query: 123 KCV 125
             V
Sbjct: 349 THV 351


>ref|NP_001152773.1| lectin, galactose binding, soluble 9 isoform 2 [Mus musculus]
 gb|AAB51189.1| beta-galactoside binding lectin
 emb|CAI24050.1| lectin, galactose binding, soluble 9 [Mus musculus]
 emb|CAI25276.1| lectin, galactose binding, soluble 9 [Mus musculus]
 dbj|BAE26856.1| unnamed protein product [Mus musculus]
 gb|EDL15600.1| lectin, galactose binding, soluble 9, isoform CRA_d [Mus musculus]
          Length = 322

 Score = 51.6 bits (122), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 31/126 (24%), Positives = 61/126 (48%), Gaps = 11/126 (8%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL-----GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAW 65
           L+ G  + ++G   + A+ F++N      G D     NPRF   G    +VCN+K  G W
Sbjct: 25  LQEGLQVTLQGTTKSFAQRFVVNFQNSFNGNDIAFHFNPRFEEGG---YVVCNTKQNGQW 81

Query: 66  GAEQRESAFPFQPGSVVE---VFNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFKI 122
           G E+R+   PFQ G   E   +  +++  + +   +  ++ +R+    ++ ++  G  K+
Sbjct: 82  GPEERKMQMPFQKGMPFELCFLVQRSEFKVMVNKKFFVQYQHRVPYHLVDTIAVSGCLKL 141

Query: 123 KCVAFE 128
             + F+
Sbjct: 142 SFITFQ 147



 Score = 45.8 bits (107), Expect = 0.001,   Method: Composition-based stats.
 Identities = 37/123 (30%), Positives = 57/123 (46%), Gaps = 12/123 (9%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAE 68
           L P + + + G V  DA  F +NL  G D     NPRFN     N +V N++   +WG E
Sbjct: 202 LYPSKSIMISGNVLPDATRFHINLRCGGDIAFHLNPRFNE----NAVVRNTQINNSWGQE 257

Query: 69  QRE--SAFPFQPGSVVEVFNQTD---LTIKLPDGYEFKFPNRL-NLEAINYLSAGGDFKI 122
           +R      PF  G    V+   +     + +   +  ++ +RL NL+ IN L   GD ++
Sbjct: 258 ERSLLGRMPFSRGQSFSVWIICEGHCFKVAVNGQHMCEYYHRLKNLQDINTLEVAGDIQL 317

Query: 123 KCV 125
             V
Sbjct: 318 THV 320


>emb|CAG32015.1| hypothetical protein [Gallus gallus]
          Length = 296

 Score = 51.6 bits (122), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 35/117 (29%), Positives = 54/117 (46%), Gaps = 5/117 (4%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNLGKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAEQR 70
           L PG  + ++GEV  + KSF +NL   D+       N        V NS    +WG E++
Sbjct: 174 LHPGCTVAIKGEVNKNPKSFTINLKSSDSKDIALHLNPRLKNKVFVRNSYLHDSWGEEEK 233

Query: 71  E-SAFPFQPGSVVEVFNQTD---LTIKLPDGYEFKFPNRL-NLEAINYLSAGGDFKI 122
           E + FPF PG   E+    D     + +   +  ++ +R   LE IN L   GD ++
Sbjct: 234 EVTNFPFSPGMYFELIIFCDAHQFKVAVNGVHTLEYKHRFKQLEKINLLEVTGDVQL 290



 Score = 48.5 bits (114), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 36/128 (28%), Positives = 57/128 (44%), Gaps = 14/128 (10%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNLG--------KDDNNLCNPRFNAHGDVNTIVCNSKDA 62
           L PGE + + G V  DA  F ++L          D     NPRF   G    +VCN+ + 
Sbjct: 26  LVPGELIVLHGSVPDDADRFQVDLQCGSSIKPRADVAFHFNPRFKWSG---CVVCNTLER 82

Query: 63  GAWGAEQRESAFPFQPG---SVVEVFNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGD 119
             WG E+     PFQ G    +V +  +    + +   +   + +R++LE I+ L   G 
Sbjct: 83  EKWGWEEITYEMPFQKGRPFEIVIMILKDKFQVSVNKKHLLLYNHRISLERIDTLGIYGK 142

Query: 120 FKIKCVAF 127
            +IK + F
Sbjct: 143 VQIKSIEF 150


>gb|ABD97855.1| galectin 8 variant I [Gallus gallus]
          Length = 296

 Score = 51.6 bits (122), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 35/117 (29%), Positives = 54/117 (46%), Gaps = 5/117 (4%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNLGKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAEQR 70
           L PG  + ++GEV  + KSF +NL   D+       N        V NS    +WG E++
Sbjct: 174 LHPGCTVAIKGEVNKNPKSFTINLKSSDSKDIALHLNPRLKNKVFVRNSYLHDSWGEEEK 233

Query: 71  E-SAFPFQPGSVVEVFNQTD---LTIKLPDGYEFKFPNRL-NLEAINYLSAGGDFKI 122
           E + FPF PG   E+    D     + +   +  ++ +R   LE IN L   GD ++
Sbjct: 234 EVTNFPFSPGMYFELIIFCDAHQFKVAVNGVHTLEYKHRFKQLEKINLLEVTGDVQL 290



 Score = 47.8 bits (112), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 35/128 (27%), Positives = 57/128 (44%), Gaps = 14/128 (10%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNLG--------KDDNNLCNPRFNAHGDVNTIVCNSKDA 62
           L PGE + + G +  DA  F ++L          D     NPRF   G    +VCN+ + 
Sbjct: 26  LVPGELIVLHGSIPDDADRFQVDLQCGSSIKPRADVAFHFNPRFKWSG---CVVCNTLER 82

Query: 63  GAWGAEQRESAFPFQPG---SVVEVFNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGD 119
             WG E+     PFQ G    +V +  +    + +   +   + +R++LE I+ L   G 
Sbjct: 83  EKWGWEEITYEMPFQKGRPFEIVIMILKDKFQVSVNKKHLLLYNHRISLERIDTLGIYGK 142

Query: 120 FKIKCVAF 127
            +IK + F
Sbjct: 143 VQIKSIEF 150


>ref|NP_034838.2| lectin, galactose binding, soluble 9 isoform 1 [Mus musculus]
 gb|EDL15599.1| lectin, galactose binding, soluble 9, isoform CRA_c [Mus musculus]
          Length = 353

 Score = 51.6 bits (122), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 31/126 (24%), Positives = 61/126 (48%), Gaps = 11/126 (8%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL-----GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAW 65
           L+ G  + ++G   + A+ F++N      G D     NPRF   G    +VCN+K  G W
Sbjct: 25  LQEGLQVTLQGTTKSFAQRFVVNFQNSFNGNDIAFHFNPRFEEGG---YVVCNTKQNGQW 81

Query: 66  GAEQRESAFPFQPGSVVE---VFNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFKI 122
           G E+R+   PFQ G   E   +  +++  + +   +  ++ +R+    ++ ++  G  K+
Sbjct: 82  GPEERKMQMPFQKGMPFELCFLVQRSEFKVMVNKKFFVQYQHRVPYHLVDTIAVSGCLKL 141

Query: 123 KCVAFE 128
             + F+
Sbjct: 142 SFITFQ 147



 Score = 45.8 bits (107), Expect = 0.001,   Method: Composition-based stats.
 Identities = 37/123 (30%), Positives = 57/123 (46%), Gaps = 12/123 (9%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAE 68
           L P + + + G V  DA  F +NL  G D     NPRFN     N +V N++   +WG E
Sbjct: 233 LYPSKSIMISGNVLPDATRFHINLRCGGDIAFHLNPRFNE----NAVVRNTQINNSWGQE 288

Query: 69  QRE--SAFPFQPGSVVEVFNQTD---LTIKLPDGYEFKFPNRL-NLEAINYLSAGGDFKI 122
           +R      PF  G    V+   +     + +   +  ++ +RL NL+ IN L   GD ++
Sbjct: 289 ERSLLGRMPFSRGQSFSVWIICEGHCFKVAVNGQHMCEYYHRLKNLQDINTLEVAGDIQL 348

Query: 123 KCV 125
             V
Sbjct: 349 THV 351


>emb|CAF93222.1| unnamed protein product [Tetraodon nigroviridis]
          Length = 329

 Score = 51.6 bits (122), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 35/127 (27%), Positives = 58/127 (45%), Gaps = 11/127 (8%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL------GKDDNNLCNPRFNAHGDVNTIVCNSKDAGA 64
           LK G+ + V G V   A  F +NL      G D     NPR++AH     +V NS   G 
Sbjct: 24  LKEGKSIAVTGRVLPGAHRFHVNLQTGSGGGADIALHVNPRYDAHPPY--VVLNSLQQGH 81

Query: 65  WGAEQRESAFPFQPGSVVE---VFNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFK 121
           W  E+R    PF  G+      V +Q    + +   +  +F +R+  + ++ +S  G+ +
Sbjct: 82  WAQEERNYTSPFAIGTTFNLLIVVSQQSYQLNVNGSFFMEFKHRVPFQHVDTISVDGNVE 141

Query: 122 IKCVAFE 128
           I  + F+
Sbjct: 142 IASIVFQ 148



 Score = 48.1 bits (113), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 37/121 (30%), Positives = 54/121 (44%), Gaps = 11/121 (9%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNLGKDDNNLC--NPRFNAHGDVNTIVCNSKDAGAWGAE 68
           L PG  + ++G V   A  F +NL          NPRF    D NT+V N++    WG+E
Sbjct: 212 LSPGRTITIQGTVKPHANRFDVNLSHSSGIALHYNPRF----DENTVVRNARQQDHWGSE 267

Query: 69  QRESAFPF---QPGSVVEVFNQTDLTIKLPDGYEFKFPNRLN-LEAINYLSAGGDFKIKC 124
           +R    PF   QP ++V         I   +G +  F +R   L+ IN +   GD  +  
Sbjct: 268 ERGGGMPFHRGQPFTLVITCEHHCFRIA-ANGVQTTFNHRFTPLQFINVVEVNGDVSLTS 326

Query: 125 V 125
           V
Sbjct: 327 V 327


>ref|NP_001010843.1| lectin, galactoside-binding, soluble, 8 (galectin 8) [Gallus
           gallus]
 gb|AAW51134.1| galectin-8 variant II [Gallus gallus]
          Length = 315

 Score = 51.6 bits (122), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 35/117 (29%), Positives = 54/117 (46%), Gaps = 5/117 (4%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNLGKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAEQR 70
           L PG  + ++GEV  + KSF +NL   D+       N        V NS    +WG E++
Sbjct: 193 LHPGCTVAIKGEVNKNPKSFTINLKSSDSKDIALHLNPRLKNKVFVRNSYLHDSWGEEEK 252

Query: 71  E-SAFPFQPGSVVEVFNQTD---LTIKLPDGYEFKFPNRL-NLEAINYLSAGGDFKI 122
           E + FPF PG   E+    D     + +   +  ++ +R   LE IN L   GD ++
Sbjct: 253 EVTNFPFSPGMYFELIIFCDAHQFKVAVNGVHTLEYKHRFKQLEKINLLEVTGDVQL 309



 Score = 48.5 bits (114), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 36/128 (28%), Positives = 57/128 (44%), Gaps = 14/128 (10%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNLG--------KDDNNLCNPRFNAHGDVNTIVCNSKDA 62
           L PGE + + G V  DA  F ++L          D     NPRF   G    +VCN+ + 
Sbjct: 26  LVPGELIVLHGSVPDDADRFQVDLQCGSSIKPRADVAFHFNPRFKWSG---CVVCNTLER 82

Query: 63  GAWGAEQRESAFPFQPG---SVVEVFNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGD 119
             WG E+     PFQ G    +V +  +    + +   +   + +R++LE I+ L   G 
Sbjct: 83  EKWGWEEITYEMPFQKGRPFEIVIMILKDKFQVSVNKKHLLLYNHRISLERIDTLGIYGK 142

Query: 120 FKIKCVAF 127
            +IK + F
Sbjct: 143 VQIKSIEF 150


>ref|NP_446314.2| galectin 8 [Rattus norvegicus]
 gb|AAH72488.1| Lectin, galactoside-binding, soluble, 8 [Rattus norvegicus]
          Length = 316

 Score = 51.6 bits (122), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 38/124 (30%), Positives = 62/124 (50%), Gaps = 13/124 (10%)

Query: 8   NLNLKPGECLRVRGEVAADAKSFLLNL----GKDDNNLCNPRFNAHGDVNTIVCNSKDAG 63
           N ++ PG  + V+GEV  +AKSF ++L     +D     NPR N    V   V NS    
Sbjct: 191 NASMGPGRTVVVKGEVNTNAKSFNVDLVAGRSRDIALHLNPRLN----VKAFVRNSFLQD 246

Query: 64  AWGAEQRE-SAFPFQPGSVVEVFNQTDL---TIKLPDGYEFKFPNRL-NLEAINYLSAGG 118
           AWG E+R  + FPF  G   E+    D+    + +   +  ++ +R  +L +I+ L+  G
Sbjct: 247 AWGEEERNITCFPFSSGMYFEMIIYCDVREFKVAVNGVHSLEYKHRFKDLSSIDTLAVDG 306

Query: 119 DFKI 122
           D ++
Sbjct: 307 DIRL 310



 Score = 45.1 bits (105), Expect = 0.002,   Method: Composition-based stats.
 Identities = 34/129 (26%), Positives = 55/129 (42%), Gaps = 16/129 (12%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNLGKDDNNL---------CNPRFNAHGDVNTIVCNSKD 61
           LKPG  + +RG V  D++ F ++  +  N+L          NPRF      N IVCN+  
Sbjct: 26  LKPGSLIVIRGHVPKDSERFQVDF-QHGNSLKPRADVAFHFNPRFKRS---NCIVCNTLT 81

Query: 62  AGAWGAEQRESAFPFQPGSVVEVFN---QTDLTIKLPDGYEFKFPNRLNLEAINYLSAGG 118
              WG E+     PF+     E+     +    + +   +   + +R+N E I+ L   G
Sbjct: 82  NEKWGWEEITHDMPFRKEKSFEIVIMVLKNKFQVAVNGKHILLYAHRINPEKIDTLGIYG 141

Query: 119 DFKIKCVAF 127
              I  + F
Sbjct: 142 KVNIHSIGF 150


>pdb|2YRO|A Chain A, Solution Structure Of The C-Terminal Gal-Bind Lectin
           Protein From Human Galectin-8
          Length = 155

 Score = 51.6 bits (122), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 39/124 (31%), Positives = 61/124 (49%), Gaps = 13/124 (10%)

Query: 8   NLNLKPGECLRVRGEVAADAKSFLLNL----GKDDNNLCNPRFNAHGDVNTIVCNSKDAG 63
           N  + PG  + V+GEV A+AKSF ++L     KD     NPR N    +   V NS    
Sbjct: 24  NTPMGPGRTVVVKGEVNANAKSFNVDLLAGKSKDIALHLNPRLN----IKAFVRNSFLQE 79

Query: 64  AWGAEQRE-SAFPFQPGSVVEVFNQTDL---TIKLPDGYEFKFPNRLN-LEAINYLSAGG 118
           +WG E+R  ++FPF PG   E+    D+    + +   +  ++ +R   L +I+ L   G
Sbjct: 80  SWGEEERNITSFPFSPGMYFEMIIYCDVREFKVAVNGVHSLEYKHRFKELSSIDTLEING 139

Query: 119 DFKI 122
           D  +
Sbjct: 140 DIHL 143


>ref|NP_001076182.1| galectin-4 [Oryctolagus cuniculus]
 gb|AAD55242.1|AF091738_1 galectin-4 [Oryctolagus cuniculus]
          Length = 328

 Score = 51.6 bits (122), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 34/128 (26%), Positives = 59/128 (46%), Gaps = 16/128 (12%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL------GKDDNNLCNPRFNAHGDVNTIVCNSKDAGA 64
           L  G  + ++G  +     F +N       G D     NPRF+     + +V NS+  G 
Sbjct: 27  LSLGMSVYIQGVASEHMNRFFVNFVVGQDPGADIAFHFNPRFDGW---DKVVFNSQQGGK 83

Query: 65  WGAEQRESAFPFQPGSVVEVF-----NQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGD 119
           WG+E+R+ + PF  G+  E+          + +     YEFK  +RL L+ + +L   GD
Sbjct: 84  WGSEERKRSMPFSKGAPFELVFTVLAEHYKVVVNGSPFYEFK--HRLPLQMVTHLHVDGD 141

Query: 120 FKIKCVAF 127
            +++ + F
Sbjct: 142 LRLQSINF 149



 Score = 41.2 bits (95), Expect = 0.028,   Method: Composition-based stats.
 Identities = 23/67 (34%), Positives = 34/67 (50%), Gaps = 1/67 (1%)

Query: 19  VRGEVAADAKSFLLNLGKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAEQRESAF-PFQ 77
           V+G V    KSFL+N     +       N       +V NS+  G+WGAE+R+ A+ PF 
Sbjct: 215 VKGYVPPTGKSFLINFKVGSSGDLALHINPRMTEGVVVRNSRLNGSWGAEERKMAYNPFG 274

Query: 78  PGSVVEV 84
           PG   ++
Sbjct: 275 PGQYFDL 281


>dbj|BAG59217.1| unnamed protein product [Homo sapiens]
          Length = 171

 Score = 51.2 bits (121), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 33/131 (25%), Positives = 63/131 (48%), Gaps = 22/131 (16%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL------GKDDNNLCNPRFNAHGDVNTIVCNSKDAGA 64
           L  G  + ++G  +   K F +N       G D     NPRF+     + +V N+   G 
Sbjct: 27  LNVGMSVYIQGVASEHVKRFFVNFVVGQDPGSDVAFHFNPRFDGW---DKVVFNTLQGGK 83

Query: 65  WGAEQRESAFPFQPGSVVEVFNQTDLTIKLPDGYE--------FKFPNRLNLEAINYLSA 116
           WG+E+R+ + PF+ G+  E+     + I L + Y+        +++ +RL L+ + +L  
Sbjct: 84  WGSEERKRSMPFKKGAAFEL-----VFIVLAEHYKVVVNGNPFYEYGHRLPLQMVTHLQV 138

Query: 117 GGDFKIKCVAF 127
            GD +++ + F
Sbjct: 139 DGDLQLQSINF 149


>gb|AAA37311.1| carbohydrate binding protein 35
          Length = 263

 Score = 51.2 bits (121), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 36/116 (31%), Positives = 59/116 (50%), Gaps = 7/116 (6%)

Query: 13  PGECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAEQR 70
           P   + + G V  +A   +L+   G D     NPRFN + +   IVCN+K    WG E+R
Sbjct: 141 PRMLITIMGTVKPNANRIVLDFRRGNDVAFHFNPRFNEN-NRRVIVCNTKQDNNWGKEER 199

Query: 71  ESAFPFQPGS--VVEVFNQTD-LTIKLPDGYEFKFPNRL-NLEAINYLSAGGDFKI 122
           +SAFPF+ G    ++V  + D   + + D +  ++ +R+ NL  I+ L    D  +
Sbjct: 200 QSAFPFESGKPFKIQVLVEADHFKVAVNDAHLLQYNHRMKNLREISQLGISRDITL 255


>dbj|BAE33025.1| unnamed protein product [Mus musculus]
          Length = 329

 Score = 51.2 bits (121), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 37/124 (29%), Positives = 62/124 (50%), Gaps = 13/124 (10%)

Query: 8   NLNLKPGECLRVRGEVAADAKSFLLNL----GKDDNNLCNPRFNAHGDVNTIVCNSKDAG 63
           N ++ PG  + ++GEV  +A+SF ++L     +D     NPR N    V   V NS    
Sbjct: 204 NASMGPGRTVVIKGEVNTNARSFNVDLVAGKTRDIALHLNPRLN----VKAFVRNSFLQD 259

Query: 64  AWGAEQRE-SAFPFQPGSVVEVFNQTDL---TIKLPDGYEFKFPNRL-NLEAINYLSAGG 118
           AWG E+R  + FPF  G   E+    D+    + +   +  ++ +R  +L +I+ LS  G
Sbjct: 260 AWGEEERNITCFPFSSGMYFEMIIYCDVREFKVAINGVHSLEYKHRFKDLSSIDTLSVDG 319

Query: 119 DFKI 122
           D ++
Sbjct: 320 DIRL 323



 Score = 38.9 bits (89), Expect = 0.16,   Method: Composition-based stats.
 Identities = 31/129 (24%), Positives = 56/129 (43%), Gaps = 16/129 (12%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNLGKDDNNL---------CNPRFNAHGDVNTIVCNSKD 61
           LKPG  + +RG V  D++ F +++ +  N+L          NPRF      + IVCN+  
Sbjct: 39  LKPGSLIVIRGHVPKDSERFQVDV-QLGNSLKPRADVAFHFNPRFKRS---SCIVCNTLT 94

Query: 62  AGAWGAEQRESAFPFQPGSVVEVFN---QTDLTIKLPDGYEFKFPNRLNLEAINYLSAGG 118
              WG E+     PF+     E+     +    + +   +   + +R++ E I+ +   G
Sbjct: 95  QEKWGWEEITYDMPFRKEKSFEIVFMVLKNKFQVAVNGRHVLLYAHRISPEQIDTVGIYG 154

Query: 119 DFKIKCVAF 127
              I  + F
Sbjct: 155 KVNIHSIGF 163


>gb|EDL32311.1| lectin, galactose binding, soluble 8, isoform CRA_b [Mus musculus]
          Length = 282

 Score = 51.2 bits (121), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 37/124 (29%), Positives = 62/124 (50%), Gaps = 13/124 (10%)

Query: 8   NLNLKPGECLRVRGEVAADAKSFLLNL----GKDDNNLCNPRFNAHGDVNTIVCNSKDAG 63
           N ++ PG  + ++GEV  +A+SF ++L     +D     NPR N    V   V NS    
Sbjct: 157 NASMGPGRTVVIKGEVNTNARSFNVDLVAGKTRDIALHLNPRLN----VKAFVRNSFLQD 212

Query: 64  AWGAEQRE-SAFPFQPGSVVEVFNQTDL---TIKLPDGYEFKFPNRL-NLEAINYLSAGG 118
           AWG E+R  + FPF  G   E+    D+    + +   +  ++ +R  +L +I+ LS  G
Sbjct: 213 AWGEEERNITCFPFSSGMYFEMIIYCDVREFKVAINGVHSLEYKHRFKDLSSIDTLSVDG 272

Query: 119 DFKI 122
           D ++
Sbjct: 273 DIRL 276


>dbj|BAC35918.1| unnamed protein product [Mus musculus]
          Length = 223

 Score = 50.8 bits (120), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 37/124 (29%), Positives = 62/124 (50%), Gaps = 13/124 (10%)

Query: 8   NLNLKPGECLRVRGEVAADAKSFLLNL----GKDDNNLCNPRFNAHGDVNTIVCNSKDAG 63
           N ++ PG  + ++GEV  +A+SF ++L     +D     NPR N    V   V NS    
Sbjct: 98  NASMGPGRTVVIKGEVNTNARSFNVDLVAGKTRDIALHLNPRLN----VKAFVRNSFLQD 153

Query: 64  AWGAEQRE-SAFPFQPGSVVEVFNQTDL---TIKLPDGYEFKFPNRL-NLEAINYLSAGG 118
           AWG E+R  + FPF  G   E+    D+    + +   +  ++ +R  +L +I+ LS  G
Sbjct: 154 AWGEEERNITCFPFSSGMYFEMIIYCDVREFKVAINGVHSLEYKHRFKDLSSIDTLSVDG 213

Query: 119 DFKI 122
           D ++
Sbjct: 214 DIRL 217


>gb|ABS45108.1| galectin-8L [Mus musculus]
          Length = 325

 Score = 50.8 bits (120), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 37/124 (29%), Positives = 62/124 (50%), Gaps = 13/124 (10%)

Query: 8   NLNLKPGECLRVRGEVAADAKSFLLNL----GKDDNNLCNPRFNAHGDVNTIVCNSKDAG 63
           N ++ PG  + ++GEV  +A+SF ++L     +D     NPR N    V   V NS    
Sbjct: 200 NASMGPGRTVVIKGEVNTNARSFNVDLVAGKTRDIALHLNPRLN----VKAFVRNSFLQD 255

Query: 64  AWGAEQRE-SAFPFQPGSVVEVFNQTDL---TIKLPDGYEFKFPNRL-NLEAINYLSAGG 118
           AWG E+R  + FPF  G   E+    D+    + +   +  ++ +R  +L +I+ LS  G
Sbjct: 256 AWGEEERNITCFPFSSGMYFEMIIYCDVREFKVAINGVHSLEYKHRFKDLSSIDTLSVDG 315

Query: 119 DFKI 122
           D ++
Sbjct: 316 DIRL 319



 Score = 38.5 bits (88), Expect = 0.19,   Method: Composition-based stats.
 Identities = 31/129 (24%), Positives = 55/129 (42%), Gaps = 16/129 (12%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNLGKDDNNL---------CNPRFNAHGDVNTIVCNSKD 61
           LKPG  + +RG V  D++ F ++  +  N+L          NPRF      + IVCN+  
Sbjct: 26  LKPGSLIVIRGHVPKDSERFQVDF-QLGNSLKPRADVAFHFNPRFKRS---SCIVCNTLT 81

Query: 62  AGAWGAEQRESAFPFQPGSVVEVFN---QTDLTIKLPDGYEFKFPNRLNLEAINYLSAGG 118
              WG E+     PF+     E+     +    + +   +   + +R++ E I+ +   G
Sbjct: 82  QEKWGWEEITYDMPFRKEKSFEIVFMVLKNKFQVAVNGRHVLLYAHRISPEQIDTVGIYG 141

Query: 119 DFKIKCVAF 127
              I  + F
Sbjct: 142 KVNIHSIGF 150


>ref|NP_006140.1| galectin-4 [Homo sapiens]
 sp|P56470|LEG4_HUMAN RecName: Full=Galectin-4; AltName: Full=Lactose-binding lectin 4;
           AltName: Full=L-36 lactose-binding protein;
           Short=L36LBP; AltName: Full=Antigen NY-CO-27
 gb|AAC51763.1| galectin-4 [Homo sapiens]
 dbj|BAA22165.1| galectin-4 [Homo sapiens]
 gb|AAB86590.1| galectin-4 [Homo sapiens]
 gb|AAH03661.1| Lectin, galactoside-binding, soluble, 4 [Homo sapiens]
 gb|AAH05146.1| Lectin, galactoside-binding, soluble, 4 [Homo sapiens]
 gb|AAH34750.1| Lectin, galactoside-binding, soluble, 4 [Homo sapiens]
 gb|AAP35679.1| lectin, galactoside-binding, soluble, 4 (galectin 4) [Homo sapiens]
 emb|CAG38781.1| LGALS4 [Homo sapiens]
 gb|AAX32077.1| lectin galactoside-binding soluble 4 [synthetic construct]
 gb|AAX32078.1| lectin galactoside-binding soluble 4 [synthetic construct]
 gb|EAW56819.1| lectin, galactoside-binding, soluble, 4 (galectin 4), isoform CRA_a
           [Homo sapiens]
 dbj|BAF82958.1| unnamed protein product [Homo sapiens]
          Length = 323

 Score = 50.8 bits (120), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 33/131 (25%), Positives = 63/131 (48%), Gaps = 22/131 (16%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL------GKDDNNLCNPRFNAHGDVNTIVCNSKDAGA 64
           L  G  + ++G  +   K F +N       G D     NPRF+     + +V N+   G 
Sbjct: 27  LNVGMSVYIQGVASEHMKRFFVNFVVGQDPGSDVAFHFNPRFDGW---DKVVFNTLQGGK 83

Query: 65  WGAEQRESAFPFQPGSVVEVFNQTDLTIKLPDGYE--------FKFPNRLNLEAINYLSA 116
           WG+E+R+ + PF+ G+  E+     + I L + Y+        +++ +RL L+ + +L  
Sbjct: 84  WGSEERKRSMPFKKGAAFEL-----VFIVLAEHYKVVVNGNPFYEYGHRLPLQMVTHLQV 138

Query: 117 GGDFKIKCVAF 127
            GD +++ + F
Sbjct: 139 DGDLQLQSINF 149



 Score = 33.1 bits (74), Expect = 7.0,   Method: Composition-based stats.
 Identities = 28/112 (25%), Positives = 50/112 (44%), Gaps = 5/112 (4%)

Query: 19  VRGEVAADAKSFLLNLGKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAEQRE-SAFPFQ 77
           ++G V    KSF +N     +       N      T+V NS   G+WG+E+++ +  PF 
Sbjct: 210 IKGYVPPTGKSFAINFKVGSSGDIALHINPRMGNGTVVRNSLLNGSWGSEEKKITHNPFG 269

Query: 78  PGSVVEVFNQTDL---TIKLPDGYEFKFPNRLN-LEAINYLSAGGDFKIKCV 125
           PG   ++  +  L    +     + F F +RL+  + ++ L   GD  +  V
Sbjct: 270 PGQFFDLSIRCGLDRFKVYANGQHLFDFAHRLSAFQRVDTLEIQGDVTLSYV 321


>gb|AAP36224.1| Homo sapiens lectin, galactoside-binding, soluble, 4 (galectin 4)
           [synthetic construct]
 gb|AAX43701.1| lectin galactoside-binding soluble 4 [synthetic construct]
 gb|AAX43702.1| lectin galactoside-binding soluble 4 [synthetic construct]
          Length = 324

 Score = 50.8 bits (120), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 33/131 (25%), Positives = 63/131 (48%), Gaps = 22/131 (16%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL------GKDDNNLCNPRFNAHGDVNTIVCNSKDAGA 64
           L  G  + ++G  +   K F +N       G D     NPRF+     + +V N+   G 
Sbjct: 27  LNVGMSVYIQGVASEHMKRFFVNFVVGQDPGSDVAFHFNPRFDGW---DKVVFNTLQGGK 83

Query: 65  WGAEQRESAFPFQPGSVVEVFNQTDLTIKLPDGYE--------FKFPNRLNLEAINYLSA 116
           WG+E+R+ + PF+ G+  E+     + I L + Y+        +++ +RL L+ + +L  
Sbjct: 84  WGSEERKRSMPFKKGAAFEL-----VFIVLAEHYKVVVNGNPFYEYGHRLPLQMVTHLQV 138

Query: 117 GGDFKIKCVAF 127
            GD +++ + F
Sbjct: 139 DGDLQLQSINF 149



 Score = 33.1 bits (74), Expect = 7.1,   Method: Composition-based stats.
 Identities = 28/112 (25%), Positives = 50/112 (44%), Gaps = 5/112 (4%)

Query: 19  VRGEVAADAKSFLLNLGKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAEQRE-SAFPFQ 77
           ++G V    KSF +N     +       N      T+V NS   G+WG+E+++ +  PF 
Sbjct: 210 IKGYVPPTGKSFAINFKVGSSGDIALHINPRMGNGTVVRNSLLNGSWGSEEKKITHNPFG 269

Query: 78  PGSVVEVFNQTDL---TIKLPDGYEFKFPNRLN-LEAINYLSAGGDFKIKCV 125
           PG   ++  +  L    +     + F F +RL+  + ++ L   GD  +  V
Sbjct: 270 PGQFFDLSIRCGLDRFKVYANGQHLFDFAHRLSAFQRVDTLEIQGDVTLSYV 321


>ref|NP_061374.1| lectin, galactose binding, soluble 8 [Mus musculus]
 sp|Q9JL15|LEG8_MOUSE RecName: Full=Galectin-8; AltName: Full=LGALS-8
 gb|AAF27645.1|AF218069_1 galectin-8 [Mus musculus]
 dbj|BAB23560.1| unnamed protein product [Mus musculus]
 gb|AAH40243.1| Lectin, galactose binding, soluble 8 [Mus musculus]
 dbj|BAC26495.1| unnamed protein product [Mus musculus]
 dbj|BAC38880.1| unnamed protein product [Mus musculus]
 emb|CAJ18459.1| Lgals8 [Mus musculus]
 dbj|BAE27406.1| unnamed protein product [Mus musculus]
 dbj|BAE26721.1| unnamed protein product [Mus musculus]
 gb|EDL32308.1| lectin, galactose binding, soluble 8, isoform CRA_a [Mus musculus]
 gb|EDL32309.1| lectin, galactose binding, soluble 8, isoform CRA_a [Mus musculus]
 gb|EDL32310.1| lectin, galactose binding, soluble 8, isoform CRA_a [Mus musculus]
 gb|EDL32312.1| lectin, galactose binding, soluble 8, isoform CRA_a [Mus musculus]
          Length = 316

 Score = 50.8 bits (120), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 37/124 (29%), Positives = 62/124 (50%), Gaps = 13/124 (10%)

Query: 8   NLNLKPGECLRVRGEVAADAKSFLLNL----GKDDNNLCNPRFNAHGDVNTIVCNSKDAG 63
           N ++ PG  + ++GEV  +A+SF ++L     +D     NPR N    V   V NS    
Sbjct: 191 NASMGPGRTVVIKGEVNTNARSFNVDLVAGKTRDIALHLNPRLN----VKAFVRNSFLQD 246

Query: 64  AWGAEQRE-SAFPFQPGSVVEVFNQTDL---TIKLPDGYEFKFPNRL-NLEAINYLSAGG 118
           AWG E+R  + FPF  G   E+    D+    + +   +  ++ +R  +L +I+ LS  G
Sbjct: 247 AWGEEERNITCFPFSSGMYFEMIIYCDVREFKVAINGVHSLEYKHRFKDLSSIDTLSVDG 306

Query: 119 DFKI 122
           D ++
Sbjct: 307 DIRL 310



 Score = 38.5 bits (88), Expect = 0.19,   Method: Composition-based stats.
 Identities = 31/129 (24%), Positives = 55/129 (42%), Gaps = 16/129 (12%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNLGKDDNNL---------CNPRFNAHGDVNTIVCNSKD 61
           LKPG  + +RG V  D++ F ++  +  N+L          NPRF      + IVCN+  
Sbjct: 26  LKPGSLIVIRGHVPKDSERFQVDF-QLGNSLKPRADVAFHFNPRFKRS---SCIVCNTLT 81

Query: 62  AGAWGAEQRESAFPFQPGSVVEVFN---QTDLTIKLPDGYEFKFPNRLNLEAINYLSAGG 118
              WG E+     PF+     E+     +    + +   +   + +R++ E I+ +   G
Sbjct: 82  QEKWGWEEITYDMPFRKEKSFEIVFMVLKNKFQVAVNGRHVLLYAHRISPEQIDTVGIYG 141

Query: 119 DFKIKCVAF 127
              I  + F
Sbjct: 142 KVNIHSIGF 150


>ref|XP_001496731.1| PREDICTED: similar to galectin-7 [Equus caballus]
          Length = 140

 Score = 50.8 bits (120), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 36/127 (28%), Positives = 58/127 (45%), Gaps = 19/127 (14%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL----GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWG 66
           ++ G  +R+RG V  +A  F +NL    G+D     +  FN   + + +V N+   G WG
Sbjct: 18  IRVGNVMRIRGVVPGNAHHFSINLVCKEGQDGEVALH--FNPRLEESIVVFNTMQEGRWG 75

Query: 67  AEQRESAFPFQPGSVVEVFNQTDLTIKLPDGYE--------FKFPNRLNLEAINYLSAGG 118
            E+R    PFQ G   +V     L I   DG++        + F +R+    +  L  GG
Sbjct: 76  REERGQGIPFQRGQPFDV-----LIITTEDGFKAVVGDSEYYHFRHRIPPANVRLLEVGG 130

Query: 119 DFKIKCV 125
           D ++  V
Sbjct: 131 DPQVDSV 137


>dbj|BAE01861.1| unnamed protein product [Macaca fascicularis]
          Length = 316

 Score = 50.8 bits (120), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 37/124 (29%), Positives = 60/124 (48%), Gaps = 13/124 (10%)

Query: 8   NLNLKPGECLRVRGEVAADAKSFLLNL----GKDDNNLCNPRFNAHGDVNTIVCNSKDAG 63
           N  + PG  + V+GEV  +AKSF ++L     KD     NPR N    +   + NS    
Sbjct: 191 NTPMGPGRTVVVKGEVNTNAKSFNVDLLAGKSKDIALHLNPRLN----IKAFIRNSFLQE 246

Query: 64  AWGAEQRE-SAFPFQPGSVVEVFNQTDL---TIKLPDGYEFKFPNRLN-LEAINYLSAGG 118
           +WG E+R  ++FPF PG   E+    D+    + +   +  ++ +R   L +I+ L   G
Sbjct: 247 SWGEEERNITSFPFSPGMYFEMIIYCDVREFKVAVNGVHSLEYKHRFKELSSIDTLEING 306

Query: 119 DFKI 122
           D  +
Sbjct: 307 DIHL 310



 Score = 39.7 bits (91), Expect = 0.076,   Method: Composition-based stats.
 Identities = 33/128 (25%), Positives = 51/128 (39%), Gaps = 14/128 (10%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNLG--------KDDNNLCNPRFNAHGDVNTIVCNSKDA 62
           L PG  + +RG V +DA  F ++L          D     NPRF   G    IVCN+   
Sbjct: 27  LDPGTLIVIRGHVPSDADRFQVDLQYGSSVKPRADVAFHFNPRFKRAG---CIVCNTLIK 83

Query: 63  GAWGAEQRESAFPFQPGSVVEVFN---QTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGD 119
             WG E+     PF+     E+     +    + +   +   + +R+  E I+ L   G 
Sbjct: 84  EKWGREEITYDTPFKREKSFEIVIMVLKDKFQVAVNGKHTLLYGHRIGTEKIDTLGIYGK 143

Query: 120 FKIKCVAF 127
             I  + F
Sbjct: 144 VNIHSIGF 151


>ref|XP_001098674.1| PREDICTED: similar to galectin 8 isoform b isoform 4 [Macaca
           mulatta]
 ref|XP_001099087.1| PREDICTED: similar to galectin 8 isoform b isoform 8 [Macaca
           mulatta]
 ref|XP_001099187.1| PREDICTED: similar to galectin 8 isoform b isoform 9 [Macaca
           mulatta]
 ref|XP_001099600.1| PREDICTED: similar to galectin 8 isoform b isoform 13 [Macaca
           mulatta]
          Length = 317

 Score = 50.8 bits (120), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 37/124 (29%), Positives = 60/124 (48%), Gaps = 13/124 (10%)

Query: 8   NLNLKPGECLRVRGEVAADAKSFLLNL----GKDDNNLCNPRFNAHGDVNTIVCNSKDAG 63
           N  + PG  + V+GEV  +AKSF ++L     KD     NPR N    +   + NS    
Sbjct: 192 NTPMGPGRTVVVKGEVNTNAKSFNVDLLAGKSKDIALHLNPRLN----IKAFIRNSFLQE 247

Query: 64  AWGAEQRE-SAFPFQPGSVVEVFNQTDL---TIKLPDGYEFKFPNRLN-LEAINYLSAGG 118
           +WG E+R  ++FPF PG   E+    D+    + +   +  ++ +R   L +I+ L   G
Sbjct: 248 SWGEEERNITSFPFSPGMYFEMIIYCDVREFKVAVNGVHSLEYKHRFKELSSIDTLEING 307

Query: 119 DFKI 122
           D  +
Sbjct: 308 DIHL 311



 Score = 39.7 bits (91), Expect = 0.076,   Method: Composition-based stats.
 Identities = 33/128 (25%), Positives = 51/128 (39%), Gaps = 14/128 (10%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNLG--------KDDNNLCNPRFNAHGDVNTIVCNSKDA 62
           L PG  + +RG V +DA  F ++L          D     NPRF   G    IVCN+   
Sbjct: 27  LDPGTLIVIRGHVPSDADRFQVDLQYGSSVKPRADVAFHFNPRFKRAG---CIVCNTLIK 83

Query: 63  GAWGAEQRESAFPFQPGSVVEVFN---QTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGD 119
             WG E+     PF+     E+     +    + +   +   + +R+  E I+ L   G 
Sbjct: 84  EKWGREEITYDTPFKREKSFEIVIMVLKDKFQVAVNGKHTLLYGHRIGTEKIDTLGIYGK 143

Query: 120 FKIKCVAF 127
             I  + F
Sbjct: 144 VNIHSIGF 151


>ref|XP_001098571.1| PREDICTED: similar to galectin 8 isoform a isoform 3 [Macaca
           mulatta]
 ref|XP_001098777.1| PREDICTED: similar to galectin 8 isoform a isoform 5 [Macaca
           mulatta]
 ref|XP_001098882.1| PREDICTED: similar to galectin 8 isoform a isoform 6 [Macaca
           mulatta]
 ref|XP_001098979.1| PREDICTED: similar to galectin 8 isoform a isoform 7 [Macaca
           mulatta]
 ref|XP_001099297.1| PREDICTED: similar to galectin 8 isoform a isoform 10 [Macaca
           mulatta]
 ref|XP_001099504.1| PREDICTED: similar to galectin 8 isoform a isoform 12 [Macaca
           mulatta]
          Length = 358

 Score = 50.8 bits (120), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 37/124 (29%), Positives = 60/124 (48%), Gaps = 13/124 (10%)

Query: 8   NLNLKPGECLRVRGEVAADAKSFLLNL----GKDDNNLCNPRFNAHGDVNTIVCNSKDAG 63
           N  + PG  + V+GEV  +AKSF ++L     KD     NPR N    +   + NS    
Sbjct: 233 NTPMGPGRTVVVKGEVNTNAKSFNVDLLAGKSKDIALHLNPRLN----IKAFIRNSFLQE 288

Query: 64  AWGAEQRE-SAFPFQPGSVVEVFNQTDL---TIKLPDGYEFKFPNRLN-LEAINYLSAGG 118
           +WG E+R  ++FPF PG   E+    D+    + +   +  ++ +R   L +I+ L   G
Sbjct: 289 SWGEEERNITSFPFSPGMYFEMIIYCDVREFKVAVNGVHSLEYKHRFKELSSIDTLEING 348

Query: 119 DFKI 122
           D  +
Sbjct: 349 DIHL 352



 Score = 39.7 bits (91), Expect = 0.076,   Method: Composition-based stats.
 Identities = 33/128 (25%), Positives = 51/128 (39%), Gaps = 14/128 (10%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNLG--------KDDNNLCNPRFNAHGDVNTIVCNSKDA 62
           L PG  + +RG V +DA  F ++L          D     NPRF   G    IVCN+   
Sbjct: 27  LDPGTLIVIRGHVPSDADRFQVDLQYGSSVKPRADVAFHFNPRFKRAG---CIVCNTLIK 83

Query: 63  GAWGAEQRESAFPFQPGSVVEVFN---QTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGD 119
             WG E+     PF+     E+     +    + +   +   + +R+  E I+ L   G 
Sbjct: 84  EKWGREEITYDTPFKREKSFEIVIMVLKDKFQVAVNGKHTLLYGHRIGTEKIDTLGIYGK 143

Query: 120 FKIKCVAF 127
             I  + F
Sbjct: 144 VNIHSIGF 151


>ref|XP_001098377.1| PREDICTED: similar to galectin 8 isoform b isoform 2 [Macaca
           mulatta]
 dbj|BAE88255.1| unnamed protein product [Macaca fascicularis]
          Length = 290

 Score = 50.8 bits (120), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 37/124 (29%), Positives = 60/124 (48%), Gaps = 13/124 (10%)

Query: 8   NLNLKPGECLRVRGEVAADAKSFLLNL----GKDDNNLCNPRFNAHGDVNTIVCNSKDAG 63
           N  + PG  + V+GEV  +AKSF ++L     KD     NPR N    +   + NS    
Sbjct: 165 NTPMGPGRTVVVKGEVNTNAKSFNVDLLAGKSKDIALHLNPRLN----IKAFIRNSFLQE 220

Query: 64  AWGAEQRE-SAFPFQPGSVVEVFNQTDL---TIKLPDGYEFKFPNRLN-LEAINYLSAGG 118
           +WG E+R  ++FPF PG   E+    D+    + +   +  ++ +R   L +I+ L   G
Sbjct: 221 SWGEEERNITSFPFSPGMYFEMIIYCDVREFKVAVNGVHSLEYKHRFKELSSIDTLEING 280

Query: 119 DFKI 122
           D  +
Sbjct: 281 DIHL 284


>pdb|2D6O|X Chain X, Crystal Structure Of Mouse Galectin-9 N-Terminal Crd In
           Complex With N-Acetyllactosamine Dimer
          Length = 159

 Score = 50.8 bits (120), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 31/126 (24%), Positives = 61/126 (48%), Gaps = 11/126 (8%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL-----GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAW 65
           L+ G  + ++G   + A+ F++N      G D     NPRF   G    +VCN+K  G W
Sbjct: 27  LQEGLQVTLQGTTKSFAQRFVVNFQNSFNGNDIAFHFNPRFEEGG---YVVCNTKQNGQW 83

Query: 66  GAEQRESAFPFQPGSVVE---VFNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFKI 122
           G E+R+   PFQ G   E   +  +++  + +   +  ++ +R+    ++ ++  G  K+
Sbjct: 84  GPEERKMQMPFQKGMPFELCFLVQRSEFKVMVNKKFFVQYQHRVPYHLVDTIAVSGCLKL 143

Query: 123 KCVAFE 128
             + F+
Sbjct: 144 SFITFQ 149


>pdb|2D6K|A Chain A, Crystal Structure Of Mouse Galectin-9 N-Terminal Crd
           (Crystal Form 1)
 pdb|2D6K|B Chain B, Crystal Structure Of Mouse Galectin-9 N-Terminal Crd
           (Crystal Form 1)
 pdb|2D6L|X Chain X, Crystal Structure Of Mouse Galectin-9 N-Terminal Crd
           (Crystal Form 2)
 pdb|2D6M|A Chain A, Crystal Structure Of Mouse Galectin-9 N-Terminal Crd In
           Complex With Lactose
 pdb|2D6M|B Chain B, Crystal Structure Of Mouse Galectin-9 N-Terminal Crd In
           Complex With Lactose
 pdb|2D6N|A Chain A, Crystal Structure Of Mouse Galectin-9 N-Terminal Crd In
           Complex With N-Acetyllactosamine
 pdb|2D6N|B Chain B, Crystal Structure Of Mouse Galectin-9 N-Terminal Crd In
           Complex With N-Acetyllactosamine
 pdb|2D6P|A Chain A, Crystal Structure Of Mouse Galectin-9 N-Terminal Crd In
           Complex With T-Antigen
 pdb|2D6P|B Chain B, Crystal Structure Of Mouse Galectin-9 N-Terminal Crd In
           Complex With T-Antigen
          Length = 159

 Score = 50.8 bits (120), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 31/126 (24%), Positives = 61/126 (48%), Gaps = 11/126 (8%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL-----GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAW 65
           L+ G  + ++G   + A+ F++N      G D     NPRF   G    +VCN+K  G W
Sbjct: 27  LQEGLQVTLQGTTKSFAQRFVVNFQNSFNGNDIAFHFNPRFEEGG---YVVCNTKQNGQW 83

Query: 66  GAEQRESAFPFQPGSVVE---VFNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFKI 122
           G E+R+   PFQ G   E   +  +++  + +   +  ++ +R+    ++ ++  G  K+
Sbjct: 84  GPEERKMQMPFQKGMPFELCFLVQRSEFKVMVNKKFFVQYQHRVPYHLVDTIAVSGCLKL 143

Query: 123 KCVAFE 128
             + F+
Sbjct: 144 SFITFQ 149


>ref|XP_855387.1| PREDICTED: similar to Galectin-4 (Lactose-binding lectin 4) (L-36
           lactose binding protein) (L36LBP) (Antigen NY-CO-27)
           [Canis familiaris]
          Length = 798

 Score = 50.8 bits (120), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 27/77 (35%), Positives = 41/77 (53%), Gaps = 2/77 (2%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAE 68
           ++ G  +R+RG V   A  F +NL  G+   +     FN   D +T+V N+ + GAWG E
Sbjct: 655 IRVGTVMRIRGVVPNKAGRFYVNLLCGEAPGSEAALHFNPRLDESTVVFNTLEQGAWGRE 714

Query: 69  QRESAFPFQPGSVVEVF 85
           +R +  PFQ G   +V 
Sbjct: 715 ERGTGIPFQRGQPFDVL 731



 Score = 45.8 bits (107), Expect = 0.001,   Method: Composition-based stats.
 Identities = 32/131 (24%), Positives = 63/131 (48%), Gaps = 22/131 (16%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL------GKDDNNLCNPRFNAHGDVNTIVCNSKDAGA 64
           L  G  + ++G  +   + F +N       G D     NPRF+     + +V NS   G 
Sbjct: 74  LSVGMSVYIQGITSEHMRRFCVNFVAGAHPGSDIAFHFNPRFDGW---DKVVFNSHLGGK 130

Query: 65  WGAEQRESAFPFQPGSVVEVFNQTDLTIKLPDGYE--------FKFPNRLNLEAINYLSA 116
           WG+E+++ + PF+ G+  E+     + + L + Y+        ++F +RL L+ + +L  
Sbjct: 131 WGSEEKKRSMPFRKGTHFEL-----VFMVLAEHYKVVVNGNPFYEFGHRLPLQLVTHLQV 185

Query: 117 GGDFKIKCVAF 127
            GD +++ + F
Sbjct: 186 EGDVELQSINF 196



 Score = 33.9 bits (76), Expect = 4.5,   Method: Composition-based stats.
 Identities = 27/106 (25%), Positives = 50/106 (47%), Gaps = 5/106 (4%)

Query: 19  VRGEVAADAKSFLLNLGKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAEQRESAF-PFQ 77
           ++G V   +KSF++N   + +       N       +V NS   G+WG+E R+ ++ PF 
Sbjct: 257 IKGFVPFTSKSFVINFMVESSGDLALHINPRLTEGLVVRNSCLNGSWGSEDRKLSYNPFI 316

Query: 78  PGSVVEVFNQTDL---TIKLPDGYEFKFPNR-LNLEAINYLSAGGD 119
           PG   ++  +  +    +     + F F +R L L+ ++ L   GD
Sbjct: 317 PGQFFDLSIRCGMDRFKVYANGQHLFDFSHRLLALQNVDMLEINGD 362


>ref|XP_001517844.1| PREDICTED: similar to urate transporter/channel protein, isoform
           (UATp,i), partial [Ornithorhynchus anatinus]
          Length = 212

 Score = 50.8 bits (120), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 34/127 (26%), Positives = 61/127 (48%), Gaps = 12/127 (9%)

Query: 11  LKPGECLRVRGEVA-ADAKSFLLNL--GKDDNNLC---NPRFNAHGDVNTIVCNSKDAGA 64
           LK G  + + G V    +  F +NL  G +D ++    NPRF    D N +VCN+K+   
Sbjct: 12  LKDGLQIIINGTVLLTGSNRFAVNLQCGGNDEDIAFHFNPRFE---DGNYVVCNTKEKDK 68

Query: 65  WGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFK 121
           WG E+R+   PFQ G   E+      +   + +   Y  ++ +RL    ++ ++  G  +
Sbjct: 69  WGKEERKMKMPFQKGLPFEIRILVQSSSFLVTVNGSYFLEYQHRLPFHRVDTINVQGSVR 128

Query: 122 IKCVAFE 128
           +  + F+
Sbjct: 129 LTFIDFQ 135


>ref|XP_002192605.1| PREDICTED: lectin, galactoside-binding, soluble, 8 (galectin 8)
           [Taeniopygia guttata]
          Length = 339

 Score = 50.4 bits (119), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 31/92 (33%), Positives = 44/92 (47%), Gaps = 8/92 (8%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNLGKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAEQR 70
           L+PG  + ++GEV  + KSF +NL   D+       N        V NS    +WG E++
Sbjct: 217 LRPGCTIAIKGEVNKNPKSFAINLRPSDSKDIALHLNPRMKNKVFVRNSYLHDSWGEEEK 276

Query: 71  E-SAFPFQPGSVVEVFNQTDLTIKLPDGYEFK 101
           E + FPF PG   E+       I   D Y+FK
Sbjct: 277 EITNFPFSPGMYFEL-------IIFCDAYQFK 301



 Score = 47.4 bits (111), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 36/128 (28%), Positives = 55/128 (42%), Gaps = 14/128 (10%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNLG--------KDDNNLCNPRFNAHGDVNTIVCNSKDA 62
           L PGE + + G V  DA  F ++L          D     NPRF   G    IVCN+ + 
Sbjct: 50  LVPGELIVIHGTVPDDADRFQVDLQCGSSIKPRADVAFHFNPRFKRSG---CIVCNTLER 106

Query: 63  GAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGD 119
             WG E+     PF  G   E+     +    + +   +   + +R++LE I+ L   G 
Sbjct: 107 EKWGWEEITYEMPFGKGKSFEIVIMILKDKFQVTVNKKHLLLYNHRISLEKIDTLGIYGK 166

Query: 120 FKIKCVAF 127
            +IK + F
Sbjct: 167 VQIKTIEF 174


>ref|XP_001099398.1| PREDICTED: similar to galectin 8 isoform a isoform 11 [Macaca
           mulatta]
          Length = 299

 Score = 50.4 bits (119), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 37/124 (29%), Positives = 60/124 (48%), Gaps = 13/124 (10%)

Query: 8   NLNLKPGECLRVRGEVAADAKSFLLNL----GKDDNNLCNPRFNAHGDVNTIVCNSKDAG 63
           N  + PG  + V+GEV  +AKSF ++L     KD     NPR N    +   + NS    
Sbjct: 174 NTPMGPGRTVVVKGEVNTNAKSFNVDLLAGKSKDIALHLNPRLN----IKAFIRNSFLQE 229

Query: 64  AWGAEQRE-SAFPFQPGSVVEVFNQTDL---TIKLPDGYEFKFPNRLN-LEAINYLSAGG 118
           +WG E+R  ++FPF PG   E+    D+    + +   +  ++ +R   L +I+ L   G
Sbjct: 230 SWGEEERNITSFPFSPGMYFEMIIYCDVREFKVAVNGVHSLEYKHRFKELSSIDTLEING 289

Query: 119 DFKI 122
           D  +
Sbjct: 290 DIHL 293



 Score = 36.6 bits (83), Expect = 0.77,   Method: Composition-based stats.
 Identities = 26/82 (31%), Positives = 35/82 (42%), Gaps = 11/82 (13%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNLG--------KDDNNLCNPRFNAHGDVNTIVCNSKDA 62
           L PG  + +RG V +DA  F ++L          D     NPRF   G    IVCN+   
Sbjct: 27  LDPGTLIVIRGHVPSDADRFQVDLQYGSSVKPRADVAFHFNPRFKRAG---CIVCNTLIK 83

Query: 63  GAWGAEQRESAFPFQPGSVVEV 84
             WG E+     PF+     E+
Sbjct: 84  EKWGREEITYDTPFKREKSFEI 105


>ref|NP_999097.1| urate transporter/channel protein, isoform (UATp,i) [Sus scrofa]
 emb|CAB44279.1| urate transporter/channel protein, isoform (UATp,i) [Sus scrofa]
          Length = 349

 Score = 50.4 bits (119), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 34/127 (26%), Positives = 61/127 (48%), Gaps = 12/127 (9%)

Query: 11  LKPGECLRVRGEVAADAKS-FLLNL--GKDDNNLC---NPRFNAHGDVNTIVCNSKDAGA 64
           L+ G  + + G V   + S F +NL  G  DN++    NPRF   G    +VCN+K  G 
Sbjct: 25  LQDGLQITINGTVLMSSGSRFTVNLQTGHSDNDIAFHFNPRFEEGG---YVVCNTKQNGI 81

Query: 65  WGAEQRESAFPFQPGSVVE---VFNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFK 121
           WG E+R+   PFQ G   E   +   +   + +      ++ +R+    ++ +S  G  +
Sbjct: 82  WGPEERKMQMPFQRGHPFELSFLVQSSQFQVTVNGRLFVQYTHRVPFHRVDTISVTGIVQ 141

Query: 122 IKCVAFE 128
           +  ++F+
Sbjct: 142 LSYISFQ 148



 Score = 42.0 bits (97), Expect = 0.017,   Method: Composition-based stats.
 Identities = 36/116 (31%), Positives = 55/116 (47%), Gaps = 12/116 (10%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAE 68
           L P + + V G +   A+SF +NL  G D     NPRF      N +V N++   +WG E
Sbjct: 235 LYPSKSIMVSGTILPSAQSFYINLRSGSDIAFHLNPRFKE----NAVVRNTQIGSSWGPE 290

Query: 69  QR--ESAFPFQPGS--VVEVFNQTDLTIKLPDG-YEFKFPNRL-NLEAINYLSAGG 118
           +R      PF  G   +V +  ++       DG + F++ +RL +L  IN L  G 
Sbjct: 291 ERGLPRKMPFSRGQSFLVWILCESHCFKVAVDGQHLFEYYHRLKHLPTINSLEVGA 346


>emb|CAB44278.1| urate transporter/channel protein (UATp) [Sus scrofa]
          Length = 317

 Score = 50.4 bits (119), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 34/127 (26%), Positives = 61/127 (48%), Gaps = 12/127 (9%)

Query: 11  LKPGECLRVRGEVAADAKS-FLLNL--GKDDNNLC---NPRFNAHGDVNTIVCNSKDAGA 64
           L+ G  + + G V   + S F +NL  G  DN++    NPRF   G    +VCN+K  G 
Sbjct: 25  LQDGLQITINGTVLMSSGSRFTVNLQTGHSDNDIAFHFNPRFEEGG---YVVCNTKQNGI 81

Query: 65  WGAEQRESAFPFQPGSVVE---VFNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFK 121
           WG E+R+   PFQ G   E   +   +   + +      ++ +R+    ++ +S  G  +
Sbjct: 82  WGPEERKMQMPFQRGHPFELSFLVQSSQFQVTVNGRLFVQYTHRVPFHRVDTISVTGIVQ 141

Query: 122 IKCVAFE 128
           +  ++F+
Sbjct: 142 LSYISFQ 148



 Score = 42.0 bits (97), Expect = 0.017,   Method: Composition-based stats.
 Identities = 36/116 (31%), Positives = 55/116 (47%), Gaps = 12/116 (10%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAE 68
           L P + + V G +   A+SF +NL  G D     NPRF      N +V N++   +WG E
Sbjct: 203 LYPSKSIMVSGTILPSAQSFYINLRSGSDIAFHLNPRFKE----NAVVRNTQIGSSWGPE 258

Query: 69  QR--ESAFPFQPGS--VVEVFNQTDLTIKLPDG-YEFKFPNRL-NLEAINYLSAGG 118
           +R      PF  G   +V +  ++       DG + F++ +RL +L  IN L  G 
Sbjct: 259 ERGLPRKMPFSRGQSFLVWILCESHCFKVAVDGQHLFEYYHRLKHLPTINSLEVGA 314


>gb|ACJ60642.1| lectin galactoside-binding soluble 9 protein [Sus scrofa]
          Length = 355

 Score = 50.4 bits (119), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 34/127 (26%), Positives = 61/127 (48%), Gaps = 12/127 (9%)

Query: 11  LKPGECLRVRGEVAADAKS-FLLNL--GKDDNNLC---NPRFNAHGDVNTIVCNSKDAGA 64
           L+ G  + + G V   + S F +NL  G  DN++    NPRF   G    +VCN+K  G 
Sbjct: 25  LQDGLQITINGTVLMSSGSRFTVNLQTGHSDNDIAFHFNPRFEEGG---YVVCNTKQNGI 81

Query: 65  WGAEQRESAFPFQPGSVVE---VFNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFK 121
           WG E+R+   PFQ G   E   +   +   + +      ++ +R+    ++ +S  G  +
Sbjct: 82  WGPEERKMQMPFQRGHPFELSFLVQSSQFQVTVNGRLFVQYTHRVPFHRVDTISVTGIVQ 141

Query: 122 IKCVAFE 128
           +  ++F+
Sbjct: 142 LSYISFQ 148



 Score = 47.8 bits (112), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 39/123 (31%), Positives = 60/123 (48%), Gaps = 12/123 (9%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAE 68
           L P + + V G +   A+SF +NL  G D     NPRF      N +V N++   +WG E
Sbjct: 235 LYPSKSIMVSGTILPSAQSFYINLRSGSDIAFHLNPRFKE----NAVVRNTQIGSSWGPE 290

Query: 69  QR--ESAFPFQPGS--VVEVFNQTDLTIKLPDG-YEFKFPNRL-NLEAINYLSAGGDFKI 122
           +R      PF  G   +V +  ++       DG + F++ +RL +L  IN L  GGD ++
Sbjct: 291 ERGLPRKMPFSRGQSFLVWILCESHCFKVAVDGQHLFEYYHRLKHLPTINSLEVGGDIQL 350

Query: 123 KCV 125
             V
Sbjct: 351 THV 353


>gb|AAD39095.1|AF105337_1 galectin GAL-1 [Teladorsagia circumcincta]
 gb|AAC47546.1| galectin [Teladorsagia circumcincta]
          Length = 278

 Score = 50.4 bits (119), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 37/118 (31%), Positives = 57/118 (48%), Gaps = 10/118 (8%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNLGKDDNNLC---NPRFNAHGDVNTIVCNSKDAGAWGA 67
           L PG+ L + G      K F +N+ K + ++    NPRF    D   +V NS  +  WG 
Sbjct: 159 LSPGKSLYLYGMPEKKGKRFHINILKKNGDIALHFNPRF----DEKAVVRNSLISNEWGN 214

Query: 68  EQRESAFPFQP--GSVVEVFNQTDLTIKLPDGYEF-KFPNRLNLEAINYLSAGGDFKI 122
           E+RE   PF+   G  +E+ N+      + +G  F  + +RL    +N L  GGD +I
Sbjct: 215 EEREGKMPFEKAVGFDLEIKNEDYAFQIMVNGERFASYAHRLEPHELNGLQIGGDVEI 272



 Score = 48.9 bits (115), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 36/119 (30%), Positives = 56/119 (47%), Gaps = 8/119 (6%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNLGKDDNNLCNPRFNAHGDVN----TIVCNSKDAGAWG 66
            +PG+ L V+G+   D+  F +NL     +        H  V      IVCNS   G WG
Sbjct: 19  FEPGQTLTVKGKTGEDSVRFTINLHNSSADFSGNDVPLHVSVRFDEGKIVCNSFAKGEWG 78

Query: 67  AEQRESAFPFQPGSVVEV-FNQTDLTIKL-PDGYEFK-FPNRLNLEAINYLSAGGDFKI 122
            E+R+S  P++ G  +++     D   ++  D  E K + +RL L +I + S  GD  I
Sbjct: 79  KEERKSN-PYKKGDDIDIRIRAHDSKFQIFVDQKELKEYEHRLPLSSITHFSIDGDVLI 136


>gb|ACO08221.1| Galectin-9 [Oncorhynchus mykiss]
          Length = 341

 Score = 50.4 bits (119), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 35/127 (27%), Positives = 62/127 (48%), Gaps = 11/127 (8%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL------GKDDNNLCNPRFNAHGDVNTIVCNSKDAGA 64
           L+ G+ + + G V   A  F +NL      G D     NPR+++H     +V N+     
Sbjct: 24  LQEGKTITITGRVHHGADRFRVNLQCGSRAGADIALHFNPRYDSHP--GYVVTNTLQQSK 81

Query: 65  WGAEQRESAFPFQPGS--VVEVFNQTD-LTIKLPDGYEFKFPNRLNLEAINYLSAGGDFK 121
           WG E+R+   PFQ GS   +E+  Q D   +K+   +   F +R+   +++ +SA G  +
Sbjct: 82  WGTEERKQHSPFQRGSSFSLEITVQRDFFQLKVNGNHFMTFKHRIPFYSVDTISADGKVE 141

Query: 122 IKCVAFE 128
           +  + F+
Sbjct: 142 LTSIVFQ 148



 Score = 40.4 bits (93), Expect = 0.051,   Method: Composition-based stats.
 Identities = 35/125 (28%), Positives = 51/125 (40%), Gaps = 12/125 (9%)

Query: 8   NLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNLC--NPRFNAHGDVNTIVCNSKDAGAW 65
           N  L PG  + ++G V  +A  F +NL  +       NPRF    D   +V NSK    W
Sbjct: 220 NGGLYPGRTINIQGVVNPNANRFHINLLFNSGIALHFNPRF----DETLVVRNSKLRDQW 275

Query: 66  GAEQRESAFPFQPGSVVEVFNQTD-----LTIKLPDGYEFKFPNRLNLEAINYLSAGGDF 120
           G E+R    PF  G    +    D     + +       +K  + L L+ +N L   GD 
Sbjct: 276 GKEERSGGMPFHRGQAFTLSITCDAQCYKIVVNGNQTSTYKHRHTL-LQQVNILEVDGDL 334

Query: 121 KIKCV 125
            +  V
Sbjct: 335 SLTSV 339


>gb|AAC47547.1| galectin [Teladorsagia circumcincta]
 gb|AAD11971.1| galectin [Trichostrongylus colubriformis]
          Length = 278

 Score = 50.1 bits (118), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 37/118 (31%), Positives = 57/118 (48%), Gaps = 10/118 (8%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNLGKDDNNLC---NPRFNAHGDVNTIVCNSKDAGAWGA 67
           L PG+ L + G      K F +N+ K + ++    NPRF    D   +V NS  +  WG 
Sbjct: 159 LAPGKSLYLYGMPEKKGKRFHINILKKNGDIALHFNPRF----DEKAVVRNSLISNEWGN 214

Query: 68  EQRESAFPFQP--GSVVEVFNQTDLTIKLPDGYEF-KFPNRLNLEAINYLSAGGDFKI 122
           E+RE   PF+   G  +E+ N+      + +G  F  + +RL    +N L  GGD +I
Sbjct: 215 EEREGKMPFEKAVGFDLEIKNEDYAFQIMVNGERFTSYAHRLEPHELNGLQIGGDVEI 272



 Score = 48.1 bits (113), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 36/119 (30%), Positives = 56/119 (47%), Gaps = 8/119 (6%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNLGKDDNNLCNPRFNAHGDVN----TIVCNSKDAGAWG 66
            +PG+ L V+G+   D+  F +NL     +        H  V      IVCNS   G WG
Sbjct: 19  FEPGQTLTVKGKTGEDSVRFTINLHNSAADFSGNDVPLHVSVRFDEGKIVCNSFAKGEWG 78

Query: 67  AEQRESAFPFQPGSVVEV-FNQTDLTIKL-PDGYEFK-FPNRLNLEAINYLSAGGDFKI 122
            E+R+S  P++ G  +++     D   ++  D  E K + +RL L +I + S  GD  I
Sbjct: 79  KEERKSN-PYKKGDDIDIRIRAHDSKFQIFVDQKELKEYEHRLPLSSITHFSIDGDVLI 136


>ref|XP_001375560.1| PREDICTED: similar to galectin-9 [Monodelphis domestica]
          Length = 280

 Score = 50.1 bits (118), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 27/102 (26%), Positives = 51/102 (50%), Gaps = 9/102 (8%)

Query: 32  LNLGKDDNNLC---NPRFNAHGDVNTIVCNSKDAGAWGAEQRESAFPFQPGSVVEVFNQ- 87
             LG   N++    NPRF    D   +VCN+K  G WG E+R+   PFQ G++ E+  Q 
Sbjct: 49  FQLGTSGNDIAFHFNPRFE---DGGYVVCNTKQNGCWGKEERKGPMPFQRGALFEIRFQV 105

Query: 88  --TDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFKIKCVAF 127
                 + +   Y  ++ +R+  + ++ ++  G  ++  ++F
Sbjct: 106 QNASFKVMVNGNYFAEYQHRIPFQWVDTITVNGMVQLAYISF 147



 Score = 48.9 bits (115), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 42/123 (34%), Positives = 54/123 (43%), Gaps = 12/123 (9%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAE 68
           L  G+ L V G +   A SF +NL  G D     NPRF      NTIV NS     WG E
Sbjct: 160 LHAGKFLLVLGSILPTADSFEINLRSGNDIAFHLNPRFQE----NTIVRNSHINYLWGPE 215

Query: 69  QR--ESAFPFQPGSVVEVF---NQTDLTIKLPDGYEFKFPNRL-NLEAINYLSAGGDFKI 122
           +R   S  PF  G    V          + +   Y F + +R+ NL +IN L   GD ++
Sbjct: 216 ERALSSVMPFIKGQTFMVLITCEAQGFKVTVNGQYLFSYSHRVKNLSSINQLEVAGDIQL 275

Query: 123 KCV 125
             V
Sbjct: 276 THV 278


>gb|AAK16736.1|AF342816_1 colorectal carcinoma-derived galectin-8 variant II [Homo sapiens]
          Length = 359

 Score = 50.1 bits (118), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 38/124 (30%), Positives = 60/124 (48%), Gaps = 13/124 (10%)

Query: 8   NLNLKPGECLRVRGEVAADAKSFLLNL----GKDDNNLCNPRFNAHGDVNTIVCNSKDAG 63
           N  + PG  + V+GEV A+AKSF ++L     KD     NPR N    +   V NS    
Sbjct: 234 NTPMGPGRTVVVKGEVNANAKSFNVDLLAGKSKDIALHLNPRLN----IKAFVRNSFLQE 289

Query: 64  AWGAEQRE-SAFPFQPGSVVEVFNQTDL---TIKLPDGYEFKFPNRLN-LEAINYLSAGG 118
           +WG E+R  ++ PF PG   E+    D+    + +   +  ++ +R   L +I+ L   G
Sbjct: 290 SWGEEERNITSLPFSPGMYFEMIIYCDVREFKVAVNGVHSLEYKHRFKELSSIDTLEING 349

Query: 119 DFKI 122
           D  +
Sbjct: 350 DIHL 353



 Score = 38.9 bits (89), Expect = 0.15,   Method: Composition-based stats.
 Identities = 33/128 (25%), Positives = 51/128 (39%), Gaps = 14/128 (10%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNLGK--------DDNNLCNPRFNAHGDVNTIVCNSKDA 62
           L PG  + +RG V +DA  F ++L          D     NPRF   G    IVCN+   
Sbjct: 27  LDPGTLIVIRGHVPSDADRFQVDLQNGSSMKPRADVAFHFNPRFKRAG---CIVCNTLIN 83

Query: 63  GAWGAEQRESAFPFQPGSVVEVFN---QTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGD 119
             WG E+     PF+     E+     +    + +   +   + +R+  E I+ L   G 
Sbjct: 84  EKWGREEITYDTPFKREKSFEIVIMVLKDKFQVAVNGKHTLLYGHRIGPEKIDTLGIYGK 143

Query: 120 FKIKCVAF 127
             I  + F
Sbjct: 144 VNIHSIGF 151


>ref|NP_001117663.1| galectin like protein [Oncorhynchus mykiss]
 dbj|BAA88670.1| galectin like protein [Oncorhynchus mykiss]
          Length = 341

 Score = 50.1 bits (118), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 35/127 (27%), Positives = 62/127 (48%), Gaps = 11/127 (8%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL------GKDDNNLCNPRFNAHGDVNTIVCNSKDAGA 64
           L+ G+ + + G V   A  F +NL      G D     NPR+++H     +V N+     
Sbjct: 24  LQEGKTITITGRVHHGADRFHVNLQCGSRAGADIALHFNPRYDSHP--GYVVTNTLQQSK 81

Query: 65  WGAEQRESAFPFQPGS--VVEVFNQTD-LTIKLPDGYEFKFPNRLNLEAINYLSAGGDFK 121
           WG E+R+   PFQ GS   +E+  Q D   +K+   +   F +R+   +++ +SA G  +
Sbjct: 82  WGTEERKQHSPFQRGSSFSLEITVQRDFFQLKVNGNHFMTFKHRIPFYSVDTISADGKVE 141

Query: 122 IKCVAFE 128
           +  + F+
Sbjct: 142 LTSIVFQ 148



 Score = 40.4 bits (93), Expect = 0.050,   Method: Composition-based stats.
 Identities = 35/125 (28%), Positives = 51/125 (40%), Gaps = 12/125 (9%)

Query: 8   NLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNLC--NPRFNAHGDVNTIVCNSKDAGAW 65
           N  L PG  + ++G V  +A  F +NL  +       NPRF    D   +V NSK    W
Sbjct: 220 NGGLYPGRTINIQGVVNPNANRFHINLLFNSGIALHFNPRF----DETLVVRNSKLRDQW 275

Query: 66  GAEQRESAFPFQPGSVVEVFNQTD-----LTIKLPDGYEFKFPNRLNLEAINYLSAGGDF 120
           G E+R    PF  G    +    D     + +       +K  + L L+ +N L   GD 
Sbjct: 276 GKEERSGGMPFHRGQAFTLSITCDAQCYKIVVNGNQTSTYKHRHTL-LQQVNILEVDGDL 334

Query: 121 KIKCV 125
            +  V
Sbjct: 335 SLTSV 339


>dbj|BAG58923.1| unnamed protein product [Homo sapiens]
          Length = 141

 Score = 50.1 bits (118), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 31/123 (25%), Positives = 60/123 (48%), Gaps = 22/123 (17%)

Query: 19  VRGEVAADAKSFLLNL------GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAEQRES 72
           ++G  +   K F +N       G D     NPRF+     + +V N+   G WG+E+R+ 
Sbjct: 5   IQGVASEHMKRFFVNFVVGQDPGSDVAFHFNPRFDGW---DKVVFNTLQGGKWGSEERKR 61

Query: 73  AFPFQPGSVVEVFNQTDLTIKLPDGYE--------FKFPNRLNLEAINYLSAGGDFKIKC 124
           + PF+ G+  E+     + I L + Y+        +++ +RL L+ + +L   GD +++ 
Sbjct: 62  SMPFKKGAAFEL-----VFIVLAEHYKVVVNGNPFYEYGHRLPLQMVTHLQVDGDLQLQS 116

Query: 125 VAF 127
           + F
Sbjct: 117 INF 119


>gb|AAL77076.1|AF468213_1 lymphocyte/NHL galectin-8 long isoform [Homo sapiens]
          Length = 359

 Score = 50.1 bits (118), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 39/124 (31%), Positives = 62/124 (50%), Gaps = 13/124 (10%)

Query: 8   NLNLKPGECLRVRGEVAADAKSFLLNL--GKDDNNL--CNPRFNAHGDVNTIVCNSKDAG 63
           N  + PG  + V+GEV A+AKSF ++L  GK  +     NPR N    +   V NS    
Sbjct: 234 NTPMGPGGTVVVKGEVNANAKSFNVDLLAGKSKHIALHLNPRLN----IKAFVRNSFLQE 289

Query: 64  AWGAEQRE-SAFPFQPGSVVEVFNQTDL---TIKLPDGYEFKFPNRLN-LEAINYLSAGG 118
           +WG E+R  ++FPF PG   E+    D+    + +   +  ++ +R   L +I+ L   G
Sbjct: 290 SWGEEERNITSFPFSPGMYFEMIIYCDVREFKVAVNGVHSLEYKHRFKELSSIDTLEING 349

Query: 119 DFKI 122
           D  +
Sbjct: 350 DIHL 353


>ref|NP_001039419.1| galectin-8 [Bos taurus]
 gb|AAI10272.1| Lectin, galactoside-binding, soluble, 8 [Bos taurus]
          Length = 357

 Score = 49.7 bits (117), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 36/124 (29%), Positives = 58/124 (46%), Gaps = 13/124 (10%)

Query: 8   NLNLKPGECLRVRGEVAADAKSFLLNL----GKDDNNLCNPRFNAHGDVNTIVCNSKDAG 63
           N ++ PG  + ++GEV  +AK F ++L     KD     NPR N    V   V NS    
Sbjct: 232 NSSMGPGRTIVIKGEVNTNAKGFTVDLLSGKSKDIALHLNPRLN----VKAFVRNSFLQE 287

Query: 64  AWGAEQRE-SAFPFQPGSVVEVF---NQTDLTIKLPDGYEFKFPNRLN-LEAINYLSAGG 118
           AWG E+R  + FPF PG   E+    +  +  + +   +  ++ +R   L  ++ L   G
Sbjct: 288 AWGEEERNITCFPFSPGMYFEMIIYCDAREFKVAVNGVHSLEYKHRFKELSKVDTLEIDG 347

Query: 119 DFKI 122
           D  +
Sbjct: 348 DIHL 351



 Score = 38.9 bits (89), Expect = 0.16,   Method: Composition-based stats.
 Identities = 32/128 (25%), Positives = 53/128 (41%), Gaps = 14/128 (10%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNLG--------KDDNNLCNPRFNAHGDVNTIVCNSKDA 62
           L+PG  + +RG V +D+  F ++L          D     NPRF      N +VCN+   
Sbjct: 26  LEPGTLIVLRGHVPSDSDRFQVDLQCGSSVKPRADVAFHFNPRFKR---ANCVVCNTLRN 82

Query: 63  GAWGAEQRESAFPFQPGSVVEVFN---QTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGD 119
             WG E+     PF+     E+     +    + +   +   + +R++ E I+ L   G 
Sbjct: 83  EKWGWEEITYDMPFKKEKSFEIVIMVLKEKFQVAVNGRHTLLYAHRISPERIDTLGIYGK 142

Query: 120 FKIKCVAF 127
             I  V F
Sbjct: 143 VIIHSVGF 150


>gb|ABC47040.1| galectin 8 [Sparus aurata]
          Length = 214

 Score = 49.7 bits (117), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 35/127 (27%), Positives = 55/127 (43%), Gaps = 14/127 (11%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNLG--------KDDNNLCNPRFNAHGDVNTIVCNSKDA 62
           L PGE + V+G V + A  F ++           D     NPRF        IVCN+   
Sbjct: 25  LLPGEMVLVQGSVPSKADRFQIDFTCGSSVKPRADVAFHFNPRFKRS---PCIVCNTLQK 81

Query: 63  GAWGAEQRESAFPFQPGSVVEVFN---QTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGD 119
             WG E+     PF PG+  E+     +    + +  G+  ++ +RL LE ++ L   G 
Sbjct: 82  ERWGREEILYQMPFAPGATFEIIFLVLRDKFKVAVNGGHVLEYQHRLELERVDTLCISGQ 141

Query: 120 FKIKCVA 126
            K++ V 
Sbjct: 142 VKVQAVG 148


>ref|XP_001098074.1| PREDICTED: similar to galectin 8 isoform b isoform 1 [Macaca
           mulatta]
          Length = 292

 Score = 49.7 bits (117), Expect = 8e-05,   Method: Composition-based stats.
 Identities = 31/82 (37%), Positives = 43/82 (52%), Gaps = 9/82 (10%)

Query: 8   NLNLKPGECLRVRGEVAADAKSFLLNL----GKDDNNLCNPRFNAHGDVNTIVCNSKDAG 63
           N  + PG  + V+GEV  +AKSF ++L     KD     NPR N    +   + NS    
Sbjct: 192 NTPMGPGRTVVVKGEVNTNAKSFNVDLLAGKSKDIALHLNPRLN----IKAFIRNSFLQE 247

Query: 64  AWGAEQRE-SAFPFQPGSVVEV 84
           +WG E+R  ++FPF PG   EV
Sbjct: 248 SWGEEERNITSFPFSPGMYFEV 269



 Score = 39.7 bits (91), Expect = 0.076,   Method: Composition-based stats.
 Identities = 33/128 (25%), Positives = 51/128 (39%), Gaps = 14/128 (10%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNLG--------KDDNNLCNPRFNAHGDVNTIVCNSKDA 62
           L PG  + +RG V +DA  F ++L          D     NPRF   G    IVCN+   
Sbjct: 27  LDPGTLIVIRGHVPSDADRFQVDLQYGSSVKPRADVAFHFNPRFKRAG---CIVCNTLIK 83

Query: 63  GAWGAEQRESAFPFQPGSVVEVFN---QTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGD 119
             WG E+     PF+     E+     +    + +   +   + +R+  E I+ L   G 
Sbjct: 84  EKWGREEITYDTPFKREKSFEIVIMVLKDKFQVAVNGKHTLLYGHRIGTEKIDTLGIYGK 143

Query: 120 FKIKCVAF 127
             I  + F
Sbjct: 144 VNIHSIGF 151


>gb|AAD11972.1| galectin [Haemonchus contortus]
          Length = 278

 Score = 49.7 bits (117), Expect = 9e-05,   Method: Composition-based stats.
 Identities = 37/118 (31%), Positives = 57/118 (48%), Gaps = 10/118 (8%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNLGKDDNNLC---NPRFNAHGDVNTIVCNSKDAGAWGA 67
           L PG+ + + G      K F +NL K + ++    NPRF    D   +V NS  +  WG 
Sbjct: 159 LAPGKSIFLYGMPEKKGKRFHINLLKKNGDIALHFNPRF----DEKAVVRNSLISNEWGN 214

Query: 68  EQRESAFPFQP--GSVVEVFNQTDLTIKLPDGYEF-KFPNRLNLEAINYLSAGGDFKI 122
           E+RE   PF+   G  +E+ N+      + +G  F  + +RL    +N L  GGD +I
Sbjct: 215 EEREGKMPFEKAVGFDLEIKNEEYAFQIMVNGERFASYAHRLEPHELNGLQIGGDVEI 272



 Score = 48.1 bits (113), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 35/119 (29%), Positives = 56/119 (47%), Gaps = 8/119 (6%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNLGKDDNNLCNPRFNAHGDVN----TIVCNSKDAGAWG 66
            +PG+ L V+G+   D+  F +NL     +        H  V      IVCNS   G WG
Sbjct: 19  FEPGQTLTVKGKTGEDSVRFTINLHNSSADFSGNDVPLHVSVRFDEGKIVCNSFAKGEWG 78

Query: 67  AEQRESAFPFQPGSVVEV-FNQTDLTIKL-PDGYEFK-FPNRLNLEAINYLSAGGDFKI 122
            E+R+S  P++ G  +++     D   ++  D  E K + +RL L ++ + S  GD  I
Sbjct: 79  KEERKSN-PYKKGDDIDIRIRAHDSKFQIFVDQKELKEYEHRLPLSSVTHFSIDGDVLI 136


>pdb|2NMN|A Chain A, Crystal Structure Of Human Galectin-3 Carbohydrate-
           Recognising Domain At 2.45 Angstrom Resolution
 pdb|2NMO|A Chain A, Crystal Structure Of Human Galectin-3 Carbohydrate-
           Recognition Domain At 1.35 Angstrom Resolution
 pdb|2NN8|A Chain A, Crystal Structure Of Human Galectin-3 Carbohydrate-
           Recognition Domain With Lactose Bound, At 1.35 Angstrom
           Resolution
          Length = 138

 Score = 49.7 bits (117), Expect = 9e-05,   Method: Composition-based stats.
 Identities = 35/121 (28%), Positives = 59/121 (48%), Gaps = 7/121 (5%)

Query: 13  PGECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAEQR 70
           P   + + G V  +A    L+   G D     NPRFN + +   IVCN+K    WG E+R
Sbjct: 16  PRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNEN-NRRVIVCNTKLDNNWGREER 74

Query: 71  ESAFPFQPGS--VVEVFNQTD-LTIKLPDGYEFKFPNRL-NLEAINYLSAGGDFKIKCVA 126
           +S FPF+ G    ++V  + D   + + D +  ++ +R+  L  I+ L   GD  +   +
Sbjct: 75  QSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSAS 134

Query: 127 F 127
           +
Sbjct: 135 Y 135


>pdb|1A3K|A Chain A, X-Ray Crystal Structure Of The Human Galectin-3
           Carbohydrate Recognition Domain (Crd) At 2.1 Angstrom
           Resolution
          Length = 137

 Score = 49.7 bits (117), Expect = 9e-05,   Method: Composition-based stats.
 Identities = 35/121 (28%), Positives = 59/121 (48%), Gaps = 7/121 (5%)

Query: 13  PGECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAEQR 70
           P   + + G V  +A    L+   G D     NPRFN + +   IVCN+K    WG E+R
Sbjct: 15  PRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNEN-NRRVIVCNTKLDNNWGREER 73

Query: 71  ESAFPFQPGS--VVEVFNQTD-LTIKLPDGYEFKFPNRL-NLEAINYLSAGGDFKIKCVA 126
           +S FPF+ G    ++V  + D   + + D +  ++ +R+  L  I+ L   GD  +   +
Sbjct: 74  QSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSAS 133

Query: 127 F 127
           +
Sbjct: 134 Y 134


>gb|AAK69827.1| lymphocyte/NHL galectin-8 short isoform [Homo sapiens]
          Length = 300

 Score = 49.7 bits (117), Expect = 9e-05,   Method: Composition-based stats.
 Identities = 39/124 (31%), Positives = 62/124 (50%), Gaps = 13/124 (10%)

Query: 8   NLNLKPGECLRVRGEVAADAKSFLLNL--GKDDNNL--CNPRFNAHGDVNTIVCNSKDAG 63
           N  + PG  + V+GEV A+AKSF ++L  GK  +     NPR N    +   V NS    
Sbjct: 175 NTPMGPGGTVVVKGEVNANAKSFNVDLLAGKSKHIALHLNPRLN----IKAFVRNSFLQE 230

Query: 64  AWGAEQRE-SAFPFQPGSVVEVFNQTDL---TIKLPDGYEFKFPNRLN-LEAINYLSAGG 118
           +WG E+R  ++FPF PG   E+    D+    + +   +  ++ +R   L +I+ L   G
Sbjct: 231 SWGEEERNITSFPFSPGMYFEMIIYCDVREFKVAVNGVHSLEYKHRFKELSSIDTLEING 290

Query: 119 DFKI 122
           D  +
Sbjct: 291 DIHL 294


>gb|ACI66798.1| Galectin-9 [Salmo salar]
          Length = 330

 Score = 49.7 bits (117), Expect = 9e-05,   Method: Composition-based stats.
 Identities = 33/126 (26%), Positives = 64/126 (50%), Gaps = 11/126 (8%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL-----GKDDNNL-CNPRFNAHGDVNTIVCNSKDAGA 64
           L  G+ + V G V   A+ F +NL     G  D  L  NPR++   DV  ++CN+     
Sbjct: 33  LHEGKTITVTGRVLPGAQRFHVNLQCGSRGNPDVALHFNPRYDGSKDV--VICNTMQHSK 90

Query: 65  WGAEQRESAFPFQPG---SVVEVFNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFK 121
           WG+E+RE       G   +++ + N+   ++ +   +  ++ +RL+  +++ +S  G  +
Sbjct: 91  WGSEEREYPASMTRGANFTLMFLVNRDSYSVIVNGAHFMEYLHRLSFSSVDTISVDGGVE 150

Query: 122 IKCVAF 127
           I+ +AF
Sbjct: 151 IQSIAF 156



 Score = 39.7 bits (91), Expect = 0.084,   Method: Composition-based stats.
 Identities = 36/121 (29%), Positives = 53/121 (43%), Gaps = 10/121 (8%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNLGKDDNNLC--NPRFNAHGDVNTIVCNSKDAGAWGAE 68
           L PG  + ++G V  +A  F +NL  +       NPRFN     N +V NS     WG E
Sbjct: 212 LYPGRNIIIQGVVNHNADKFCVNLRFNSGVALHFNPRFNE----NIVVRNSLLKEQWGPE 267

Query: 69  QRESAFPFQPGS--VVEVFNQTDLTIKLPDGYE-FKFPNR-LNLEAINYLSAGGDFKIKC 124
           +R    PF  G    V +   T     + +G + F + +R   L+ I+ L   GD  +  
Sbjct: 268 ERTGGMPFYRGQPFTVTIMCDTKCYRVMVNGVQMFSYNHRHFLLQEIDILEVEGDVSLSS 327

Query: 125 V 125
           V
Sbjct: 328 V 328


>gb|AAA37314.1| 34 kDa beta-galactoside-binding lectin (L-34)
          Length = 139

 Score = 49.3 bits (116), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 27/69 (39%), Positives = 38/69 (55%), Gaps = 3/69 (4%)

Query: 13  PGECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAEQR 70
           P   + + G V  +A   +L+   G D     NPRFN + +   IVCN+K    WG E+R
Sbjct: 44  PRMLITIMGTVKPNANRIVLDFRRGNDVAFHFNPRFNEN-NRRLIVCNTKQDNNWGKEER 102

Query: 71  ESAFPFQPG 79
           +SAFPF+ G
Sbjct: 103 QSAFPFESG 111


>sp|Q62665|LEG8_RAT RecName: Full=Galectin-8; AltName: Full=30 kDa S-type lectin;
           AltName: Full=RL-30
 gb|AAA66359.1| 30 kDa S-type lectin
          Length = 316

 Score = 49.3 bits (116), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 37/124 (29%), Positives = 61/124 (49%), Gaps = 13/124 (10%)

Query: 8   NLNLKPGECLRVRGEVAADAKSFLLNL----GKDDNNLCNPRFNAHGDVNTIVCNSKDAG 63
           N ++ PG  + V+GEV  +A SF ++L     +D     NPR N    V   V NS    
Sbjct: 191 NASMGPGRTVVVKGEVNTNATSFNVDLVAGRSRDIALHLNPRLN----VKAFVRNSFLQD 246

Query: 64  AWGAEQRE-SAFPFQPGSVVEVFNQTDL---TIKLPDGYEFKFPNRL-NLEAINYLSAGG 118
           AWG E+R  + FPF  G   E+    D+    + +   +  ++ +R  +L +I+ L+  G
Sbjct: 247 AWGEEERNITCFPFSSGMYFEMIIYCDVREFKVAVNGVHSLEYKHRFKDLSSIDTLAVDG 306

Query: 119 DFKI 122
           D ++
Sbjct: 307 DIRL 310



 Score = 44.7 bits (104), Expect = 0.003,   Method: Composition-based stats.
 Identities = 34/129 (26%), Positives = 55/129 (42%), Gaps = 16/129 (12%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNLGKDDNNL---------CNPRFNAHGDVNTIVCNSKD 61
           LKPG  + +RG V  D++ F ++  +  N+L          NPRF      N IVCN+  
Sbjct: 26  LKPGSLIVIRGHVPKDSERFQVDF-QHGNSLKPRADVAFHFNPRFKRS---NCIVCNTLT 81

Query: 62  AGAWGAEQRESAFPFQPGSVVEVFN---QTDLTIKLPDGYEFKFPNRLNLEAINYLSAGG 118
              WG E+     PF+     E+     +    + +   +   + +R+N E I+ L   G
Sbjct: 82  NEKWGWEEITHDMPFRKEKSFEIVIMVLKNKFHVAVNGKHILLYAHRINPEKIDTLGIFG 141

Query: 119 DFKIKCVAF 127
              I  + F
Sbjct: 142 KVNIHSIGF 150


>ref|XP_001471707.1| PREDICTED: hypothetical protein [Mus musculus]
          Length = 302

 Score = 49.3 bits (116), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 31/131 (23%), Positives = 66/131 (50%), Gaps = 22/131 (16%)

Query: 11  LKPGECLRVRGEVAADAKSFLLN--LGKDDNNLC----NPRFNAHGDVNTIVCNSKDAGA 64
           L  G  + ++G    + + F +N  +G+DD        NPRF+     + +V N+  +G 
Sbjct: 27  LSVGMSVYIQGMAKENMRRFHVNFAVGQDDGADVAFHFNPRFDGW---DKVVFNTMQSGQ 83

Query: 65  WGAEQRESAFPFQPGSVVEVFNQTDLTIKLPDGYE--------FKFPNRLNLEAINYLSA 116
           WG E+++ + PFQ G   E+     + + +P+ Y+        +++ +RL ++ + +L  
Sbjct: 84  WGKEEKKKSMPFQKGKHFEL-----VFMVMPEHYKVVVNGNSFYEYGHRLPVQMVTHLQV 138

Query: 117 GGDFKIKCVAF 127
            GD +++ + F
Sbjct: 139 DGDLELQSINF 149



 Score = 37.0 bits (84), Expect = 0.51,   Method: Composition-based stats.
 Identities = 36/122 (29%), Positives = 57/122 (46%), Gaps = 26/122 (21%)

Query: 19  VRGEVAADAKSFLLNL----GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAEQRESAF 74
           ++G V   A++F++N       D     NPR    GD  ++V NS   G+WGAE+R+ A+
Sbjct: 190 IKGYVLPTARNFVINFKVGSSGDIALHLNPRI---GD--SVVRNSFMNGSWGAEERKVAY 244

Query: 75  -PFQPGSVVEVFNQTDLTIK--------LPDG-YEFKFPNRLN-LEAINYLSAGGDFKIK 123
            PF PG         DL+I+          +G + F F +R    + ++ L   GD  + 
Sbjct: 245 NPFGPGQFF------DLSIRCGMDRFKVFANGQHLFDFSHRFQAFQMVDTLEINGDITLS 298

Query: 124 CV 125
            V
Sbjct: 299 YV 300


>ref|XP_001918023.1| PREDICTED: similar to lectin, galactoside-binding, soluble, 9
           (galectin 9) [Equus caballus]
          Length = 361

 Score = 49.3 bits (116), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 35/127 (27%), Positives = 64/127 (50%), Gaps = 13/127 (10%)

Query: 11  LKPGECLRVRGEV-AADAKSFLLNL--GKDDNNLC---NPRFNAHGDVNTIVCNSKDAGA 64
           L+ G  + VRG V A+    F +N   G+ D+++    NP+F   G    +VCN+K+ G 
Sbjct: 24  LQEGLQITVRGTVLASSGTRFAVNFQTGRSDDDIAFHFNPQFEEGG---YLVCNTKEKGR 80

Query: 65  WGAEQRESAFPFQPGSVVE---VFNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFK 121
           WG E++ +  PFQ  S  E   +   +   + L      ++P+R+    ++ LS  G  +
Sbjct: 81  WGQEEK-THLPFQRRSPFELSFLVLSSCFQVMLNGSPFVRYPHRVPFHRVDTLSVTGTVQ 139

Query: 122 IKCVAFE 128
           +  ++F+
Sbjct: 140 LSSISFQ 146



 Score = 40.8 bits (94), Expect = 0.039,   Method: Composition-based stats.
 Identities = 36/120 (30%), Positives = 54/120 (45%), Gaps = 12/120 (10%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAE 68
           L P + + V G V   A+SF +NL  G D      P F       T+V N++  G+WG  
Sbjct: 241 LYPSKSIVVSGTVLHSAQSFHINLRSGSDVAFHLKPLFKE----KTVVLNTQIDGSWGHV 296

Query: 69  QR--ESAFPFQPGSVVEVFNQTD---LTIKLPDGYEFKFPNRL-NLEAINYLSAGGDFKI 122
           ++      PF  G    V+   +   L + +   +   + +RL NL AIN L   GD K+
Sbjct: 297 EKTLSGKMPFTRGRSFSVWITCEARCLRVDVDGQHLCDYNHRLKNLHAINVLEVAGDIKL 356


>dbj|BAE00669.1| unnamed protein product [Macaca fascicularis]
          Length = 123

 Score = 49.3 bits (116), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 36/121 (29%), Positives = 59/121 (48%), Gaps = 13/121 (10%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL----GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWG 66
           + PG  + V+GEV  +AKSF ++L     KD     NPR N    +   + NS    +WG
Sbjct: 1   MGPGRTVVVKGEVNTNAKSFNVDLLAGKSKDIALHLNPRLN----IKAFIRNSFLQESWG 56

Query: 67  AEQRE-SAFPFQPGSVVEVFNQTDL---TIKLPDGYEFKFPNRLN-LEAINYLSAGGDFK 121
            E+R  ++FPF PG   E+    D+    + +   +  ++ +R   L +I+ L   GD  
Sbjct: 57  EEERNITSFPFSPGMYFEMIIYCDVREFKVAVNGVHSLEYKHRFKELSSIDTLEINGDIH 116

Query: 122 I 122
           +
Sbjct: 117 L 117


Searching..................................................done


Results from round 2


                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value
Sequences used in model and found again:

ref|NP_001135409.1| galectin-1 [Papio anubis] >gi|161598215|gb|A...   194   2e-48
gb|ABX74931.1| beta-galactoside-binding lectin precursor [Vareci...   194   3e-48
sp|P81184|LEG1_SHEEP RecName: Full=Galectin-1; AltName: Full=Lec...   194   3e-48
sp|P48538|LEG1_CRIGR RecName: Full=Galectin-1; AltName: Full=Lec...   193   4e-48
ref|XP_001083427.1| PREDICTED: lectin, galactoside-binding, solu...   193   5e-48
ref|NP_063969.1| lectin, galactoside-binding, soluble, 1 [Rattus...   193   5e-48
ref|XP_001501082.1| PREDICTED: similar to Galectin-1 (Lectin gal...   192   6e-48
gb|AAH02063.1| Lectin, galactose binding, soluble 1 [Mus musculus]    192   7e-48
ref|NP_786976.1| galectin-1 [Bos taurus] >gi|126174|sp|P11116|LE...   192   8e-48
ref|NP_032521.1| lectin, galactose binding, soluble 1 [Mus muscu...   192   9e-48
pdb|1SLA|A Chain A, X-Ray Crystallography Reveals Crosslinking O...   192   9e-48
gb|ABX74930.1| beta-galactoside-binding lectin precursor [Ateles...   192   1e-47
gb|AAP36586.1| Homo sapiens lectin, galactoside-binding, soluble...   191   2e-47
ref|NP_002296.1| galectin-1 [Homo sapiens] >gi|114686335|ref|XP_...   190   3e-47
gb|AAA37667.1| beta-galactoside binding protein                       190   3e-47
pdb|1GZW|B Chain B, X-Ray Crystal Structure Of Human Galectin-1 ...   190   3e-47
sp|Q49I35|LEG1_PIG RecName: Full=Galectin-1; AltName: Full=Lecti...   189   6e-47
gb|ABE01403.1| galectin 1 [Sus scrofa]                                188   1e-46
pdb|1GZW|A Chain A, X-Ray Crystal Structure Of Human Galectin-1       188   2e-46
gb|AAT37622.1| galectin-1 [Sus scrofa]                                188   2e-46
ref|NP_001001867.1| galectin 1 [Sus scrofa] >gi|90421309|gb|ABD9...   187   2e-46
pdb|1W6Q|B Chain B, X-Ray Crystal Structure Of R111h Human Galec...   187   2e-46
ref|NP_001126310.1| lectin, galactoside-binding, soluble, 1 [Pon...   187   3e-46
pdb|1W6M|B Chain B, X-Ray Crystal Structure Of C2s Human Galecti...   187   3e-46
ref|NP_001009287.1| galectin 1 [Ovis aries] >gi|47779226|gb|AAT3...   186   4e-46
ref|XP_001161991.1| PREDICTED: hypothetical protein isoform 1 [P...   186   5e-46
ref|XP_549042.2| PREDICTED: similar to Galectin-1 (Beta-galactos...   186   5e-46
ref|XP_001083299.1| PREDICTED: lectin, galactoside-binding, solu...   186   5e-46
ref|XP_852831.1| PREDICTED: similar to Galectin-1 (Beta-galactos...   186   6e-46
pdb|1W6Q|A Chain A, X-Ray Crystal Structure Of R111h Human Galec...   185   1e-45
pdb|1W6M|A Chain A, X-Ray Crystal Structure Of C2s Human Galecti...   185   1e-45
pdb|2ZKN|A Chain A, X-Ray Structure Of Mutant Galectin-1LACTOSE ...   181   2e-44
ref|XP_001510347.1| PREDICTED: similar to Galectin-1 (Lectin gal...   180   2e-44
ref|XP_001376589.1| PREDICTED: similar to Chain B, X-Ray Crystal...   165   7e-40
ref|XP_002195307.1| PREDICTED: galectin CG-16 [Taeniopygia guttata]   160   3e-38
ref|NP_996788.1| galectin CG-16 [Gallus gallus] >gi|126165|sp|P2...   160   3e-38
pdb|1QMJ|A Chain A, Cg-16, A Homodimeric Agglutinin From Chicken...   160   3e-38
ref|NP_990826.1| galectin-1 [Gallus gallus] >gi|126163|sp|P07583...   158   2e-37
prf||1304250A lectin,beta galactoside binding                         158   2e-37
gb|ACH44734.1| putative galectin CG-16 [Taeniopygia guttata]          155   1e-36
gb|ABW04130.1| galactoside binding lectin [Epinephelus coioides]      154   2e-36
dbj|BAC56336.1| similar to galactose-binding lectin [Bos taurus]      154   3e-36
ref|NP_001079039.1| galectin-Ia [Xenopus laevis] >gi|18147670|db...   153   6e-36
emb|CAA36183.1| unnamed protein product [Mus musculus]                152   7e-36
ref|NP_001079744.1| hypothetical protein LOC379433 [Xenopus laev...   152   1e-35
ref|NP_001134631.1| Beta-galactoside-binding lectin [Salmo salar...   151   2e-35
gb|ACM08322.1| Beta-galactoside-binding lectin [Salmo salar] >gi...   151   2e-35
gb|ACO07656.1| Beta-galactoside-binding lectin [Oncorhynchus myk...   150   3e-35
ref|NP_001076182.1| galectin-4 [Oryctolagus cuniculus] >gi|58821...   150   5e-35
gb|ACO07452.1| Beta-galactoside-binding lectin [Oncorhynchus myk...   150   5e-35
gb|ACM08580.1| Beta-galactoside-binding lectin [Salmo salar]          149   6e-35
gb|AAH71424.1| Lgals1l2 protein [Danio rerio]                         149   6e-35
ref|NP_998059.1| proto galectin Gal1-L2 [Danio rerio] >gi|402881...   149   6e-35
dbj|BAG59217.1| unnamed protein product [Homo sapiens]                149   9e-35
emb|CAA34206.1| unnamed protein product [Mus sp.]                     147   2e-34
sp|P16110|LEG3_MOUSE RecName: Full=Galectin-3; AltName: Full=Gal...   147   2e-34
ref|NP_034835.1| galectin 3 [Mus musculus] >gi|225543163|ref|NP_...   147   2e-34
gb|EDL20744.1| lectin, galactose binding, soluble 3, isoform CRA...   147   2e-34
ref|NP_001136314.1| lectin, galactoside-binding, soluble, 3 [Sus...   147   2e-34
dbj|BAC56513.1| similar to galactose-binding lectin [Bos taurus]      147   2e-34
ref|NP_037107.1| lectin, galactoside-binding, soluble, 4 [Rattus...   147   3e-34
ref|NP_001029940.1| galectin-4 [Bos taurus] >gi|122145086|sp|Q3T...   147   3e-34
sp|P47953|LEG3_CRILO RecName: Full=Galectin-3; AltName: Full=Gal...   147   3e-34
gb|AAP36224.1| Homo sapiens lectin, galactoside-binding, soluble...   147   3e-34
ref|NP_006140.1| galectin-4 [Homo sapiens] >gi|3024079|sp|P56470...   147   3e-34
gb|ACO08799.1| Beta-galactoside-binding lectin [Oncorhynchus myk...   147   3e-34
ref|XP_855387.1| PREDICTED: similar to Galectin-4 (Lactose-bindi...   147   4e-34
ref|NP_034836.1| lectin, galactose binding, soluble 4 [Mus muscu...   147   4e-34
gb|AAH94008.1| Lectin, galactose binding, soluble 4 [Mus musculus]    147   4e-34
ref|XP_001084043.1| PREDICTED: galectin 4 [Macaca mulatta]            146   5e-34
ref|XP_001495783.2| PREDICTED: similar to lectin, galactose bind...   145   1e-33
ref|XP_001148520.1| PREDICTED: galectin 9 isoform 2 [Pan troglod...   145   1e-33
gb|AAH27504.1| Lgals2 protein [Mus musculus]                          145   1e-33
ref|XP_001148579.1| PREDICTED: galectin 9 isoform 3 [Pan troglod...   145   1e-33
ref|XP_001471707.1| PREDICTED: hypothetical protein [Mus musculus]    145   1e-33
gb|ACO08703.1| Beta-galactoside-binding lectin [Oncorhynchus myk...   145   1e-33
ref|XP_001362707.1| PREDICTED: similar to galectin-4 isoform 2 [...   144   2e-33
ref|NP_033665.1| galectin-9 isoform long [Homo sapiens] >gi|3041...   144   2e-33
dbj|BAA31542.1| ecalectin [Homo sapiens] >gi|193785124|dbj|BAG54...   144   2e-33
ref|NP_002299.2| galectin-9 isoform short [Homo sapiens] >gi|181...   144   2e-33
gb|ABJ80692.1| beta-galactoside-binding lectin [Hippoglossus hip...   144   2e-33
ref|XP_001148447.1| PREDICTED: galectin 9 isoform 1 [Pan troglod...   144   3e-33
gb|EAW51042.1| lectin, galactoside-binding, soluble, 9 (galectin...   143   3e-33
gb|EAW80661.1| hCG22119, isoform CRA_c [Homo sapiens]                 143   3e-33
ref|XP_001148424.1| PREDICTED: similar to galactose-specific lec...   143   3e-33
ref|NP_002297.2| galectin 3 [Homo sapiens] >gi|215274262|sp|P179...   143   3e-33
ref|XP_001497400.2| PREDICTED: similar to Galectin-4 (Lactose-bi...   143   3e-33
gb|AAA88086.1| galactose-specific lectin [Homo sapiens]               143   4e-33
sp|Q9CQW5|LEG2_MOUSE RecName: Full=Galectin-2 >gi|12840865|dbj|B...   143   4e-33
ref|NP_114020.1| galectin 3 [Rattus norvegicus] >gi|203174|gb|AA...   143   4e-33
ref|XP_001087063.1| PREDICTED: similar to lectin, galactoside-bi...   143   4e-33
sp|P08699|LEG3_RAT RecName: Full=Galectin-3; AltName: Full=Galac...   143   4e-33
dbj|BAB83623.1| galectin-9 [Homo sapiens] >gi|119571423|gb|EAW51...   143   4e-33
dbj|BAD92628.1| LGALS3 protein variant [Homo sapiens]                 143   4e-33
gb|AAA35607.1| IgE-binding protein >gi|186922|gb|AAA36163.1| lam...   143   5e-33
sp|P38486|LEG3_CANFA RecName: Full=Galectin-3; AltName: Full=Gal...   143   5e-33
gb|AAA16211.1| beta-galactosides-binding lectin                       143   5e-33
ref|XP_853675.1| PREDICTED: similar to Galectin-3 (Galactose-spe...   143   5e-33
emb|CAG46894.1| LGALS3 [Homo sapiens]                                 143   5e-33
gb|AAX37050.1| lectin galactoside-binding soluble 3 [synthetic c...   143   5e-33
gb|AAM44060.1|AF510729_1 galectin-4 [Mus musculus]                    143   6e-33
gb|AAH68068.1| Lectin, galactoside-binding, soluble, 3 [Homo sap...   143   6e-33
gb|AAA37311.1| carbohydrate binding protein 35                        143   6e-33
pdb|1GAN|A Chain A, Complex Of Toad Ovary Galectin With N-Acetyl...   142   6e-33
gb|EAW80659.1| hCG22119, isoform CRA_b [Homo sapiens]                 142   7e-33
ref|NP_001075807.1| lectin, galactoside-binding, soluble, 3 [Ory...   142   8e-33
dbj|BAE43211.1| unnamed protein product [Mus musculus]                142   8e-33
emb|CAG04110.1| unnamed protein product [Tetraodon nigroviridis]      142   8e-33
ref|NP_001090970.1| lectin, galactoside-binding, soluble, 3 [Sus...   142   8e-33
dbj|BAB25661.1| unnamed protein product [Mus musculus]                142   1e-32
ref|NP_001117663.1| galectin like protein [Oncorhynchus mykiss] ...   142   1e-32
dbj|BAF98709.1| unnamed protein product [Homo sapiens]                142   1e-32
gb|ACH44733.1| putative galectin CG-16 [Taeniopygia guttata]          142   1e-32
gb|AAX37150.1| lectin galactoside-binding soluble 2 [synthetic c...   141   1e-32
ref|NP_006489.1| lectin, galactoside-binding, soluble, 2 [Homo s...   141   1e-32
dbj|BAG58923.1| unnamed protein product [Homo sapiens]                141   1e-32
ref|XP_001156690.1| PREDICTED: hypothetical protein isoform 2 [P...   141   2e-32
ref|XP_001504129.2| PREDICTED: similar to galectin 9 short isofo...   141   2e-32
emb|CAB93851.1| galectin-9 [Homo sapiens]                             141   2e-32
ref|XP_001156930.1| PREDICTED: hypothetical protein isoform 5 [P...   141   2e-32
ref|XP_001499566.1| PREDICTED: similar to lectin, galactoside-bi...   141   2e-32
gb|AAC27245.1| galectin-4 [Mus musculus]                              141   2e-32
gb|AAI05944.1| Lectin, galactoside-binding, soluble, 9B [Homo sa...   141   2e-32
dbj|BAF82952.1| unnamed protein product [Homo sapiens]                141   2e-32
sp|Q3B8N2|LEG9B_HUMAN RecName: Full=Galectin-9B; AltName: Full=G...   141   2e-32
ref|NP_001036150.1| galectin-9 like [Homo sapiens]                    141   2e-32
pdb|1HLC|A Chain A, X-Ray Crystal Structure Of The Human Dimeric...   141   2e-32
gb|AAH29063.2| LGALS2 protein [Homo sapiens]                          141   2e-32
ref|XP_001156813.1| PREDICTED: hypothetical protein isoform 3 [P...   141   2e-32
ref|NP_001035167.2| galectin 9 like [Homo sapiens]                    140   2e-32
sp|Q6DKI2|LEG9C_HUMAN RecName: Full=Galectin-9C; AltName: Full=G...   140   3e-32
ref|XP_001504125.1| PREDICTED: similar to galectin 9 short isofo...   140   3e-32
ref|NP_001095811.1| galectin 3 [Bos taurus] >gi|151553789|gb|AAI...   140   3e-32
ref|NP_999146.1| galectin-4 [Sus scrofa] >gi|2833353|sp|Q29058|L...   140   4e-32
ref|NP_034837.1| lectin, galactose binding, soluble 6 [Mus muscu...   140   4e-32
ref|XP_525588.2| PREDICTED: lectin, galactoside-binding, soluble...   140   4e-32
dbj|BAD96952.1| galectin 9 short isoform variant [Homo sapiens]       140   4e-32
gb|ACO08221.1| Galectin-9 [Oncorhynchus mykiss]                       140   4e-32
gb|AAC27244.1| galectin-6 [Mus musculus]                              140   5e-32
ref|NP_079898.1| lectin, galactose-binding, soluble 2 [Mus muscu...   140   5e-32
gb|EDL15598.1| lectin, galactose binding, soluble 9, isoform CRA...   140   5e-32
sp|P56217|LEG1_BUFAR RecName: Full=Galectin-1 >gi|3892010|pdb|1A...   139   6e-32
gb|ACI67584.1| Galectin-9 [Salmo salar]                               139   6e-32
gb|AAA36171.1| beta-galactoside-binding lectin                        139   7e-32
ref|NP_001003345.1| galectin-9 [Canis lupus familiaris] >gi|4610...   139   7e-32
gb|AAH03754.1| Lgals9 protein [Mus musculus]                          139   7e-32
emb|CAI24051.1| lectin, galactose binding, soluble 9 [Mus muscul...   139   7e-32
sp|O08573|LEG9_MOUSE RecName: Full=Galectin-9 >gi|1916604|gb|AAB...   139   7e-32
ref|NP_034838.2| lectin, galactose binding, soluble 9 isoform 1 ...   139   8e-32
ref|NP_001152773.1| lectin, galactose binding, soluble 9 isoform...   139   8e-32
sp|Q3MHZ8|LEG9_BOVIN RecName: Full=Galectin-9 >gi|75775171|gb|AA...   139   9e-32
gb|AAA48626.1| 16 kDa beta-galactoside-binding lectin                 138   1e-31
ref|XP_001083444.1| PREDICTED: lectin, galactoside-binding, solu...   138   1e-31
ref|XP_001375542.1| PREDICTED: similar to lectin, galactoside-bi...   138   1e-31
ref|NP_598283.1| lectin, galactoside-binding, soluble 2 [Rattus ...   138   1e-31
ref|XP_001507412.1| PREDICTED: similar to promyelocytic leukemia...   138   1e-31
ref|NP_001005958.1| lectin, galactoside-binding, soluble, 1 (gal...   138   2e-31
ref|XP_001375560.1| PREDICTED: similar to galectin-9 [Monodelphi...   138   2e-31
ref|XP_001517844.1| PREDICTED: similar to urate transporter/chan...   138   2e-31
pdb|2EAK|A Chain A, Crystal Structure Of Human Galectin-9 N-Term...   138   2e-31
ref|NP_001034266.1| galectin-9 isoform 1 [Bos taurus]                 138   2e-31
gb|AAH42911.2| LGALS7B protein [Homo sapiens]                         138   2e-31
sp|P97840|LEG9_RAT RecName: Full=Galectin-9; AltName: Full=36 kD...   137   2e-31
ref|NP_002298.1| galectin-7 [Homo sapiens] >gi|109948279|ref|NP_...   137   2e-31
ref|NP_001082394.1| galectin family xgalectin-VIIIa [Xenopus lae...   137   2e-31
dbj|BAC55887.1| galectin family xgalectin-VIIIa [Xenopus laevis]      137   2e-31
gb|ACI33460.1| Galectin-9 [Salmo salar] >gi|223648464|gb|ACN1099...   137   2e-31
pdb|3GAL|A Chain A, Crystal Structure Of Human Galectin-7 In Com...   137   3e-31
gb|EDM05383.1| rCG33388, isoform CRA_a [Rattus norvegicus]            137   3e-31
gb|AAB51192.1| 36 kDa beta-galactoside binding lectin                 137   3e-31
ref|NP_999097.1| urate transporter/channel protein, isoform (UAT...   137   3e-31
emb|CAB44278.1| urate transporter/channel protein (UATp) [Sus sc...   137   4e-31
ref|NP_001015570.1| galectin-9 isoform 2 [Bos taurus] >gi|598583...   137   4e-31
gb|ACJ60642.1| lectin galactoside-binding soluble 9 protein [Sus...   137   4e-31
ref|NP_037109.1| lectin, galactoside-binding, soluble, 9 [Rattus...   137   4e-31
dbj|BAC56327.1| similar to galactose-binding lectin [Bos taurus]      136   5e-31
ref|NP_956808.1| lectin, galactoside-binding, soluble, 1 (galect...   136   5e-31
ref|XP_531742.1| PREDICTED: similar to lectin, galactoside-bindi...   136   6e-31
pdb|2DYC|A Chain A, Crystal Structure Of The N-Terminal Domain O...   136   7e-31
ref|XP_001915607.1| PREDICTED: similar to urate transporter/chan...   136   7e-31
ref|XP_001330970.1| PREDICTED: hypothetical protein [Danio rerio]     135   9e-31
ref|XP_002196044.1| PREDICTED: similar to lectin galactoside-bin...   135   1e-30
pdb|2D6O|X Chain X, Crystal Structure Of Mouse Galectin-9 N-Term...   135   1e-30
pdb|2D6K|A Chain A, Crystal Structure Of Mouse Galectin-9 N-Term...   135   1e-30
gb|ACI66798.1| Galectin-9 [Salmo salar]                               135   1e-30
ref|NP_001135558.1| lectin, galactoside-binding, soluble, 8 (gal...   135   1e-30
ref|NP_001116913.1| lectin, galactoside-binding, soluble, 2 [Xen...   134   2e-30
sp|O54974|LEG7_MOUSE RecName: Full=Galectin-7; Short=Gal-7 >gi|2...   134   2e-30
ref|NP_001134305.1| Galectin-3 [Salmo salar] >gi|209732232|gb|AC...   134   2e-30
ref|NP_032522.2| lectin, galactose binding, soluble 7 [Mus muscu...   134   2e-30
ref|XP_861690.1| PREDICTED: similar to lectin, galactoside-bindi...   134   3e-30
ref|NP_001118080.1| VHSV-induced protein-9 [Oncorhynchus mykiss]...   134   3e-30
ref|XP_001915598.1| PREDICTED: similar to galectin 9, partial [E...   134   3e-30
dbj|BAC56326.1| similar to galactose-binding lectin [Bos taurus]      133   3e-30
ref|XP_002192605.1| PREDICTED: lectin, galactoside-binding, solu...   133   3e-30
gb|AAH88813.1| Lgals9-prov protein [Xenopus tropicalis]               133   4e-30
pdb|1KJL|A Chain A, High Resolution X-Ray Structure Of Human Gal...   133   4e-30
gb|ABC47040.1| galectin 8 [Sparus aurata]                             133   5e-30
emb|CAI11728.1| novel protein similar to vertebrate lectin, gala...   133   5e-30
gb|AAI53700.1| Lgals9 protein [Xenopus tropicalis]                    133   5e-30
gb|AAB40658.1| galectin-7 [Rattus norvegicus]                         133   5e-30
dbj|BAB26108.1| unnamed protein product [Mus musculus]                133   6e-30
gb|AAF61069.1|AF220550_1 galectin [Paralichthys olivaceus]            133   6e-30
ref|XP_001918023.1| PREDICTED: similar to lectin, galactoside-bi...   133   6e-30
ref|XP_001367884.1| PREDICTED: similar to galectin-7 [Monodelphi...   133   6e-30
ref|NP_001133778.1| Galectin-8 [Salmo salar] >gi|209155304|gb|AC...   132   7e-30
gb|AAK29385.1|AF331640_1 beta-galactoside-binding protein galect...   132   9e-30
ref|NP_072104.2| lectin, galactose binding, soluble 7 [Rattus no...   132   9e-30
ref|NP_001135709.1| hypothetical protein LOC100216286 [Xenopus (...   132   1e-29
gb|AAB88871.1| galectin-7 [Rattus norvegicus]                         132   1e-29
ref|XP_392379.2| PREDICTED: similar to Galectin-4 (Lactose-bindi...   132   1e-29
gb|EDM15848.1| lectin, galactoside-binding, soluble 2, isoform C...   132   1e-29
pdb|2NMN|A Chain A, Crystal Structure Of Human Galectin-3 Carboh...   131   1e-29
ref|NP_496165.3| gaLECtin family member (lec-2) [Caenorhabditis ...   131   2e-29
ref|XP_001376472.1| PREDICTED: similar to S-lac lectin [Monodelp...   131   2e-29
ref|XP_001156867.1| PREDICTED: hypothetical protein isoform 4 [P...   131   2e-29
pdb|1A3K|A Chain A, X-Ray Crystal Structure Of The Human Galecti...   131   2e-29
gb|EDL20743.1| lectin, galactose binding, soluble 3, isoform CRA...   130   2e-29
gb|AAA41378.1| IgE binding protein                                    130   3e-29
gb|AAI06496.1| LOC733366 protein [Xenopus laevis]                     130   3e-29
ref|NP_001082204.1| galectin family xgalectin-IIa [Xenopus laevi...   130   3e-29
sp|Q29373|LEG2_PIG RecName: Full=Galectin-2                           130   3e-29
gb|EDL88351.1| lectin, galactose binding, soluble 3, isoform CRA...   130   3e-29
gb|ACI69049.1| Galectin-2 [Salmo salar]                               130   4e-29
gb|AAH93113.1| Lgals3l protein [Danio rerio]                          130   4e-29
ref|XP_001788803.1| PREDICTED: similar to galectin-14 [Bos taurus]    130   4e-29
ref|XP_001370559.1| PREDICTED: similar to hCG22119, [Monodelphis...   130   5e-29
ref|XP_001519384.1| PREDICTED: similar to galectin-7 [Ornithorhy...   130   5e-29
gb|ACI68076.1| Galectin-2 [Salmo salar] >gi|223646284|gb|ACN0990...   130   5e-29
ref|NP_001010843.1| lectin, galactoside-binding, soluble, 8 (gal...   130   5e-29
emb|CAG32015.1| hypothetical protein [Gallus gallus]                  130   5e-29
ref|NP_001011449.1| lectin, galactoside-binding, soluble, 4 (gal...   130   5e-29
ref|NP_999858.2| chimera galectin Gal3 [Danio rerio] >gi|7916011...   129   6e-29
gb|AAR84191.1| chimera galectin Gal3 [Danio rerio]                    129   6e-29
gb|ABD97855.1| galectin 8 variant I [Gallus gallus]                   129   6e-29
ref|NP_001079041.1| galectin 4 [Xenopus laevis] >gi|27884291|dbj...   128   1e-28
emb|CAF93222.1| unnamed protein product [Tetraodon nigroviridis]      128   1e-28
ref|NP_001140054.1| Galectin-4 [Salmo salar] >gi|221221532|gb|AC...   128   1e-28
gb|EDL88352.1| lectin, galactose binding, soluble 3, isoform CRA...   128   1e-28
emb|CAF87201.1| unnamed protein product [Tetraodon nigroviridis]      128   2e-28
ref|XP_001255073.1| PREDICTED: similar to lectin, galactose bind...   128   2e-28
ref|NP_001123680.1| hypothetical protein LOC100170434 [Xenopus (...   128   2e-28
ref|NP_001068962.1| lectin, galactoside-binding, soluble, 2 [Bos...   127   2e-28
ref|XP_001496714.1| PREDICTED: similar to galectin-7 [Equus caba...   127   2e-28
ref|NP_001136315.1| lectin, galactoside-binding, soluble, 7 [Sus...   127   2e-28
gb|ACN10131.1| Galectin-2 [Salmo salar] >gi|223672601|gb|ACN1248...   127   3e-28
ref|XP_001510438.1| PREDICTED: similar to beta-galactoside-bindi...   126   8e-28
ref|NP_001009251.1| galectin-14 [Ovis aries] >gi|17226660|gb|AAL...   125   1e-27
ref|NP_037108.1| lectin, galactose binding, soluble 5 [Rattus no...   125   1e-27
ref|NP_001039419.1| galectin-8 [Bos taurus] >gi|82571499|gb|AAI1...   125   1e-27
emb|CAD61918.1| unnamed protein product [Homo sapiens]                125   2e-27
ref|XP_001492208.1| PREDICTED: similar to Lectin, galactoside-bi...   124   2e-27
gb|EAW70053.1| lectin, galactoside-binding, soluble, 8 (galectin...   124   2e-27
gb|AAK16736.1|AF342816_1 colorectal carcinoma-derived galectin-8...   124   3e-27
gb|AAL77076.1|AF468213_1 lymphocyte/NHL galectin-8 long isoform ...   123   3e-27
ref|NP_001082202.1| galectin family xgalectin-IIIa [Xenopus laev...   123   3e-27
ref|NP_006490.3| galectin-8 isoform a [Homo sapiens] >gi|4254419...   123   3e-27
gb|AAH77487.1| Xgalectin-IIIa protein [Xenopus laevis]                123   3e-27
gb|AAK69827.1| lymphocyte/NHL galectin-8 short isoform [Homo sap...   123   3e-27
ref|NP_001120550.1| hypothetical protein LOC100145704 [Xenopus (...   123   4e-27
ref|XP_001157611.1| PREDICTED: galectin 8 isoform 1 [Pan troglod...   123   4e-27
ref|NP_001079245.1| lactose-binding lectin [Xenopus laevis] >gi|...   123   5e-27
ref|NP_446314.2| galectin 8 [Rattus norvegicus] >gi|47938975|gb|...   123   5e-27
gb|EAW70055.1| lectin, galactoside-binding, soluble, 8 (galectin...   123   5e-27
gb|AAD45403.1| Po66 carbohydrate binding protein 1 [Homo sapiens...   122   7e-27
ref|NP_963837.1| galectin-8 isoform b [Homo sapiens] >gi|4254419...   122   7e-27
ref|NP_001022189.1| gaLECtin family member (lec-2) [Caenorhabdit...   122   7e-27
sp|O00214|LEG8_HUMAN RecName: Full=Galectin-8; Short=Gal-8; AltN...   122   8e-27
gb|AAD45404.1| Po66 carbohydrate binding protein 2 [Homo sapiens]     122   8e-27
dbj|BAD93151.1| Galectin-8 variant [Homo sapiens]                     122   8e-27
ref|XP_001158092.1| PREDICTED: galectin 8 isoform 9 [Pan troglod...   122   8e-27
gb|AAB51605.1| prostate carcinoma tumor antigen [Homo sapiens]        122   9e-27
dbj|BAG58824.1| unnamed protein product [Homo sapiens]                122   9e-27
ref|XP_001157677.1| PREDICTED: similar to Galectin-8 variant iso...   122   9e-27
sp|P08520|LEG_ELEEL RecName: Full=Beta-galactoside-binding lecti...   122   9e-27
ref|NP_001079042.1| galectin family xgalectin-Vb [Xenopus laevis...   122   9e-27
pdb|2YRO|A Chain A, Solution Structure Of The C-Terminal Gal-Bin...   122   1e-26
gb|AAI69857.1| Galectin family xgalectin-Vb [Xenopus laevis] >gi...   122   1e-26
ref|XP_536335.2| PREDICTED: similar to galectin 8 isoform a [Can...   122   1e-26
gb|AAF19370.1| galectin-8 [Homo sapiens] >gi|208966326|dbj|BAG73...   122   1e-26
gb|AAD45402.1| Po66 carbohydrate binding protein [Homo sapiens]       122   1e-26
ref|XP_001098074.1| PREDICTED: similar to galectin 8 isoform b i...   122   1e-26
ref|XP_001156415.1| PREDICTED: hypothetical protein isoform 1 [P...   122   1e-26
emb|CAA62904.1| Galectin-8 [Homo sapiens]                             121   2e-26
dbj|BAG58799.1| unnamed protein product [Homo sapiens]                121   2e-26
ref|XP_001496731.1| PREDICTED: similar to galectin-7 [Equus caba...   121   2e-26
ref|XP_001098377.1| PREDICTED: similar to galectin 8 isoform b i...   121   2e-26
ref|XP_001098571.1| PREDICTED: similar to galectin 8 isoform a i...   121   2e-26
gb|EAW51040.1| lectin, galactoside-binding, soluble, 9 (galectin...   121   2e-26
ref|XP_001158037.1| PREDICTED: similar to lymphocyte/NHL galecti...   121   2e-26
dbj|BAG59256.1| unnamed protein product [Homo sapiens]                121   2e-26
gb|AAC47547.1| galectin [Teladorsagia circumcincta] >gi|3341813|...   121   2e-26
ref|XP_001099398.1| PREDICTED: similar to galectin 8 isoform a i...   121   2e-26
dbj|BAE33025.1| unnamed protein product [Mus musculus]                121   2e-26
sp|Q62665|LEG8_RAT RecName: Full=Galectin-8; AltName: Full=30 kD...   121   2e-26
gb|AAD39095.1|AF105337_1 galectin GAL-1 [Teladorsagia circumcinc...   121   3e-26
ref|XP_001098674.1| PREDICTED: similar to galectin 8 isoform b i...   120   3e-26
dbj|BAE01861.1| unnamed protein product [Macaca fascicularis]         120   3e-26
gb|AAD11972.1| galectin [Haemonchus contortus]                        120   4e-26
emb|CAG01500.1| unnamed protein product [Tetraodon nigroviridis]      120   5e-26
gb|ABS45108.1| galectin-8L [Mus musculus]                             119   9e-26
gb|EDM06985.1| lectin, galactoside-binding, soluble 8, isoform C...   118   1e-25
gb|EDL32311.1| lectin, galactose binding, soluble 8, isoform CRA...   118   1e-25
ref|NP_001136299.1| lectin, galactoside-binding, soluble, 8 [Sus...   118   1e-25
ref|NP_061374.1| lectin, galactose binding, soluble 8 [Mus muscu...   118   1e-25
ref|XP_781871.1| PREDICTED: hypothetical protein [Strongylocentr...   118   2e-25
pir||B28302 beta-galactoside-binding lectin, placental - human  ...   118   2e-25
dbj|BAC35918.1| unnamed protein product [Mus musculus]                117   2e-25
gb|AAF63404.1|AF105967_1 galectin [Haemonchus contortus]              117   2e-25
ref|NP_001096318.1| hypothetical protein LOC100124899 [Xenopus (...   117   3e-25
gb|AAF37721.1|AF237486_1 galectin [Brugia malayi]                     117   3e-25
gb|ABN54798.1| galectin 4-like protein transcript variant [Halio...   117   4e-25
ref|XP_001678521.1| Hypothetical protein CBG13371 [Caenorhabditi...   116   5e-25
gb|ABS28869.1| tandem repeat galectin [Biomphalaria glabrata]         116   7e-25
gb|ABQ09359.1| tandem-repeat galectin [Biomphalaria glabrata]         116   7e-25
pdb|1WLC|A Chain A, Congerin Ii Y16sT88I DOUBLE MUTANT                115   2e-24
dbj|BAE00669.1| unnamed protein product [Macaca fascicularis]         114   2e-24
gb|AAA20541.1| beta-galactoside-binding lectin                        114   2e-24
ref|XP_001896448.1| galectin [Brugia malayi] >gi|158596375|gb|ED...   114   3e-24
gb|EEC12826.1| galectin, putative [Ixodes scapularis]                 113   3e-24
gb|ACO51808.1| Galectin-1 [Rana catesbeiana]                          113   5e-24
pdb|1WLW|A Chain A, Congerin Ii Y16s Single Mutant                    113   5e-24
pdb|1WLD|A Chain A, Congerin Ii T88i Single Mutant                    113   5e-24
ref|XP_001900812.1| galectin [Brugia malayi] >gi|158591679|gb|ED...   113   6e-24
sp|Q801X7|AJL1_ANGJA RecName: Full=Galactose-binding lectin l-1;...   113   7e-24
gb|AAF37720.1|AF237485_1 galectin [Dirofilaria immitis]               112   8e-24
gb|ACM08436.1| Beta-galactoside-binding lectin [Salmo salar]          112   1e-23
ref|XP_001678524.1| Hypothetical protein CBG13368 [Caenorhabditi...   112   1e-23
sp|Q9YIC2|LEG2_CONMY RecName: Full=Congerin-2; AltName: Full=Con...   111   2e-23
pdb|1IS3|A Chain A, Lactose And Mes-Liganded Congerin Ii >gi|241...   111   2e-23
dbj|BAA36385.1| Conger eel galectin (Congerin I) [Conger myriaster]   111   2e-23
dbj|BAC56536.1| similar to galactose-binding lectin [Bos taurus]      111   2e-23
pdb|1C1F|A Chain A, Ligand-Free Congerin I >gi|6435675|pdb|1C1L|...   111   2e-23
ref|XP_001376599.1| PREDICTED: similar to Galectin-1 (Lectin gal...   110   5e-23
sp|P26788|LEG1_CONMY RecName: Full=Congerin-1; AltName: Full=Con...   109   1e-22
emb|CAI11727.1| novel protein similar to vertebrate lectin, gala...   108   2e-22
gb|AAA37313.1| 14 kDa beta-galactoside-binding lectin (L-14.5)        107   3e-22
ref|XP_001895582.1| Galactoside-binding lectin family protein [B...   105   1e-21
ref|NP_497763.1| gaLECtin family member (lec-4) [Caenorhabditis ...   103   3e-21
gb|AAA37314.1| 34 kDa beta-galactoside-binding lectin (L-34)          103   4e-21
ref|XP_002126450.1| PREDICTED: similar to galectin 8 [Ciona inte...   102   9e-21
dbj|BAB11970.1| galectin LEC-4 [Caenorhabditis elegans]               102   1e-20
gb|ACO36044.1| galectin [Pinctada fucata]                              95   1e-18
ref|XP_001234400.1| PREDICTED: similar to galectin-2 related pro...    92   2e-17
ref|XP_422899.2| PREDICTED: similar to galectin-2 related protei...    92   2e-17

Sequences not found previously or not previously below threshold:

ref|XP_001362619.1| PREDICTED: similar to galectin-4 isoform 1 [...   146   6e-34
emb|CAA88922.1| galectin [Homo sapiens]                               140   2e-32
pdb|2YY1|A Chain A, Crystal Sturcture Of N-Terminal Domain Of Hu...   137   3e-31
gb|ABM74074.1| galectin-6 [Mus musculus castaneus]                    136   7e-31
ref|XP_001085890.1| PREDICTED: similar to Galectin-3 (Galactose-...   133   3e-30
dbj|BAB83259.1| galectin family xgalectin-IVa [Xenopus laevis]        133   6e-30
gb|AAI08826.1| Xgalectin-iva protein [Xenopus laevis]                 133   6e-30
gb|AAH84416.1| Xgalectin-iva protein [Xenopus laevis]                 133   6e-30
gb|AAH97632.1| Xgalectin-iva protein [Xenopus laevis]                 133   6e-30
ref|XP_002248728.1| hypothetical protein BRAFLDRAFT_289597 [Bran...   131   2e-29
ref|XP_002230376.1| hypothetical protein BRAFLDRAFT_126856 [Bran...   131   2e-29
gb|AAH56859.1| Xgalectin-iva protein [Xenopus laevis]                 131   2e-29
ref|NP_999756.1| galectin 3 [Gallus gallus] >gi|19568746|gb|AAL9...   129   8e-29
ref|XP_002200440.1| PREDICTED: galectin 3 [Taeniopygia guttata]       128   1e-28
emb|CAE17637.1| novel protein similar to vertebrate galectins [D...   128   2e-28
gb|AAR84192.1| tandem-repeat galectin Gal9-L1 [Danio rerio]           127   5e-28
gb|ACI67845.1| Galectin-9 [Salmo salar]                               126   6e-28
gb|AAH95566.1| Zgc:92326 [Danio rerio]                                126   8e-28
ref|NP_001001817.1| galactoside-binding soluble lectin 9 [Danio ...   125   8e-28
ref|NP_956366.1| lectin, galactoside-binding, soluble, 9 (galect...   125   1e-27
emb|CAE17638.1| novel protein similar to vertebrate galectins [D...   125   1e-27
gb|AAH76011.1| Zgc:92326 protein [Danio rerio]                        125   1e-27
emb|CAE17639.1| novel protein similar to vertebrate galectins [D...   125   1e-27
gb|ABO25859.1| galectin-3 [Gallus gallus]                             125   1e-27
gb|AAB02856.1| galectin-3                                             125   1e-27
emb|CAI13769.1| lectin, galactoside-binding, soluble, 8 [Homo sa...   124   2e-27
gb|EAW70057.1| lectin, galactoside-binding, soluble, 8 (galectin...   124   3e-27
emb|CAI13772.1| lectin, galactoside-binding, soluble, 8 [Homo sa...   123   3e-27
emb|CAI13768.1| lectin, galactoside-binding, soluble, 8 [Homo sa...   123   4e-27
emb|CAF89524.1| unnamed protein product [Tetraodon nigroviridis]      123   6e-27
gb|EDM05381.1| rCG35210 [Rattus norvegicus]                           122   7e-27
emb|CAI13767.1| lectin, galactoside-binding, soluble, 8 [Homo sa...   122   8e-27
ref|NP_001079643.1| similar to lectin, galactose binding, solubl...   121   2e-26
emb|CAI13766.1| lectin, galactoside-binding, soluble, 8 [Homo sa...   120   3e-26
ref|XP_001519379.1| PREDICTED: similar to galectin-4, partial [O...   120   5e-26
ref|XP_001161075.1| PREDICTED: lectin, galactoside-binding, solu...   119   8e-26
ref|XP_522043.1| PREDICTED: lectin, galactoside-binding, soluble...   119   9e-26
pdb|2YV8|A Chain A, Crystal Structure Of N-Terminal Domain Of Hu...   118   2e-25
ref|XP_001602230.1| PREDICTED: similar to galectin 4-like protei...   118   2e-25
gb|AAH99354.1| Xgalectin-IIIb protein [Xenopus laevis]                117   4e-25
ref|NP_001082398.1| galectin family xgalectin-IIIb [Xenopus laev...   117   4e-25
ref|XP_688206.3| PREDICTED: similar to galectin 8 [Danio rerio]       117   5e-25
ref|NP_001136316.1| lectin, galactoside-binding, soluble, 12 [Su...   116   6e-25
ref|XP_001115802.1| PREDICTED: similar to lectin, galactoside-bi...   116   6e-25
ref|NP_988986.1| hypothetical protein LOC394583 [Xenopus (Silura...   115   1e-24
emb|CAJ82971.1| lectin, galactoside-binding, soluble, 3 (galecti...   115   1e-24
ref|NP_001099803.1| lectin, galactoside-binding, soluble, 12 [Ra...   115   2e-24
ref|NP_149092.2| lectin, galactoside-binding, soluble, 12 isofor...   114   2e-24
dbj|BAG63109.1| unnamed protein product [Homo sapiens]                114   2e-24
ref|NP_001136008.1| lectin, galactoside-binding, soluble, 12 iso...   114   2e-24
ref|NP_001022532.1| gaLECtin family member (lec-3) [Caenorhabdit...   114   3e-24
ref|XP_001518275.1| PREDICTED: similar to galectin-12 splice for...   113   4e-24
gb|AAG40863.1|AF310686_1 galectin-12 splice form 1 [Homo sapiens]     113   4e-24
ref|XP_540894.2| PREDICTED: similar to lectin, galactoside-bindi...   113   5e-24
ref|NP_001022533.1| gaLECtin family member (lec-3) [Caenorhabdit...   113   5e-24
ref|NP_496801.2| gaLECtin family member (lec-1) [Caenorhabditis ...   113   6e-24
ref|NP_001022405.1| gaLECtin family member (lec-1) [Caenorhabdit...   113   6e-24
ref|NP_496159.1| gaLECtin family member (lec-3) [Caenorhabditis ...   112   7e-24
ref|XP_001495576.2| PREDICTED: similar to lectin, galactoside-bi...   112   9e-24
ref|NP_001022531.1| gaLECtin family member (lec-3) [Caenorhabdit...   112   1e-23
dbj|BAC39498.1| unnamed protein product [Mus musculus]                112   1e-23
ref|XP_001160989.1| PREDICTED: similar to galectin-12 splice for...   111   2e-23
ref|XP_001160945.1| PREDICTED: similar to galectin-12 isoform c ...   111   2e-23
ref|XP_001679448.1| Hypothetical protein CBG02815 [Caenorhabditi...   111   2e-23
gb|AAF63405.1|AF105968_1 galectin [Haemonchus contortus]              111   3e-23
gb|AAF63406.1|AF105969_1 galectin [Haemonchus contortus] >gi|300...   110   3e-23
sp|O44126|LEG1_HAECO RecName: Full=32 kDa beta-galactoside-bindi...   110   3e-23
gb|EDL33316.1| lectin, galactose binding, soluble 12, isoform CR...   110   3e-23
gb|AAK77326.1|AF244978_1 galectin-12 [Mus musculus] >gi|15010848...   110   3e-23
pdb|1X50|A Chain A, Solution Structure Of The C-Terminal Gal-Bin...   110   4e-23
gb|EAW51041.1| lectin, galactoside-binding, soluble, 9 (galectin...   110   4e-23
dbj|BAC28345.1| unnamed protein product [Mus musculus]                110   4e-23
gb|AAH30890.1| Lgals12 protein [Mus musculus]                         110   4e-23
ref|NP_062389.1| lectin, galactose binding, soluble 12 [Mus musc...   110   4e-23
ref|NP_001136007.1| lectin, galactoside-binding, soluble, 12 iso...   110   5e-23
ref|XP_001115794.1| PREDICTED: similar to lectin, galactoside-bi...   110   5e-23
gb|EAW74153.1| lectin, galactoside-binding, soluble, 12 (galecti...   110   6e-23
gb|EAW56820.1| lectin, galactoside-binding, soluble, 4 (galectin...   110   6e-23
ref|XP_704272.2| PREDICTED: similar to Galectin-3 (Galactose-spe...   109   6e-23
ref|XP_001115789.1| PREDICTED: similar to lectin, galactoside-bi...   109   6e-23
ref|XP_597134.2| PREDICTED: similar to lectin, galactoside-bindi...   109   1e-22
ref|XP_001809056.1| PREDICTED: similar to galectin 4-like protei...   109   1e-22
gb|AAG40864.1|AF310687_1 galectin-12 splice form 2 [Homo sapiens]     108   1e-22
gb|AAP05998.1| galectin [Haemonchus contortus]                        108   1e-22
ref|NP_001082396.1| galectin family xgalectin-VIa [Xenopus laevi...   108   2e-22
gb|AAA65445.1| galectin-5                                             107   3e-22
emb|CAG13238.1| unnamed protein product [Tetraodon nigroviridis]      107   3e-22
ref|NP_001136009.1| lectin, galactoside-binding, soluble, 12 iso...   107   3e-22
ref|NP_001136010.1| lectin, galactoside-binding, soluble, 12 iso...   107   4e-22
gb|EEB14046.1| galectin, putative [Pediculus humanus corporis]        106   6e-22
emb|CAX12786.1| novel protein [Danio rerio]                           106   7e-22
gb|EEC11690.1| galectin, putative [Ixodes scapularis]                 106   8e-22
dbj|BAF43802.1| galectin [Ornithodoros moubata] >gi|134131403|db...   104   3e-21
ref|XP_001599653.1| PREDICTED: similar to conserved hypothetical...   103   4e-21
ref|NP_001096100.1| hypothetical protein LOC100124603 [Danio rer...   103   7e-21
emb|CAF89634.1| unnamed protein product [Tetraodon nigroviridis]      102   8e-21
gb|AAH54324.1| Xgalectin-VIa protein [Xenopus laevis]                 102   9e-21
ref|NP_001003430.1| galectin related inter-fiber protein [Danio ...   102   1e-20
ref|XP_002087369.1| GE16549 [Drosophila yakuba] >gi|194173470|gb...   101   3e-20
ref|XP_002056028.1| GJ10448 [Drosophila virilis] >gi|194142737|g...   100   5e-20
ref|XP_002190965.1| PREDICTED: similar to galectin related inter...   100   6e-20
ref|XP_001961593.1| GF15050 [Drosophila ananassae] >gi|190615290...    99   8e-20
ref|XP_001999300.1| GI23146 [Drosophila mojavensis] >gi|19391589...    99   1e-19
ref|NP_001034900.1| hypothetical protein LOC556717 [Danio rerio]...    99   1e-19
ref|XP_001812825.1| PREDICTED: similar to CG32226 CG32226-PA [Tr...    99   2e-19
gb|EEB16079.1| Galectin-4, putative [Pediculus humanus corporis]       98   2e-19
ref|XP_001657304.1| galectin [Aedes aegypti] >gi|157138456|ref|X...    98   2e-19
ref|XP_002059113.1| GJ16209 [Drosophila virilis] >gi|194155987|g...    98   3e-19
ref|XP_001989432.1| GH11722 [Drosophila grimshawi] >gi|193905432...    98   3e-19
ref|XP_002020956.1| GL16594 [Drosophila persimilis] >gi|19411790...    97   3e-19
ref|NP_001023758.2| hypothetical protein DC2.3 [Caenorhabditis e...    97   3e-19
ref|XP_001921992.1| PREDICTED: similar to galectin 9 short [Dani...    97   3e-19
ref|XP_001357096.2| GA10954 [Drosophila pseudoobscura pseudoobsc...    97   4e-19
emb|CAP26737.1| Hypothetical protein CBG06431 [Caenorhabditis br...    97   4e-19
ref|XP_001334396.2| PREDICTED: similar to chimera galectin Gal3 ...    97   6e-19
ref|NP_001023759.2| hypothetical protein DC2.3 [Caenorhabditis e...    96   7e-19
ref|XP_001901075.1| Galactoside-binding lectin family protein [B...    96   9e-19
emb|CAN87718.1| novel protein containing a galactoside-binding l...    96   9e-19
ref|XP_002041522.1| GM16712 [Drosophila sechellia] >gi|194123295...    96   9e-19
ref|XP_319586.2| galectin (AGAP008844-PA) [Anopheles gambiae str...    96   9e-19
gb|ACN63483.1| MIP07035p [Drosophila melanogaster]                     96   1e-18
ref|XP_002069239.1| GK21075 [Drosophila willistoni] >gi|19416532...    96   1e-18
gb|ACA09732.1| tandem repeat galectin [Venerupis philippinarum]        96   1e-18
ref|XP_002077579.1| GD22998 [Drosophila simulans] >gi|194189588|...    95   1e-18
ref|NP_608487.1| galectin [Drosophila melanogaster] >gi|19421844...    95   2e-18
ref|XP_001665578.1| hypothetical protein CBG09221 [Caenorhabditi...    95   2e-18
ref|XP_001968113.1| GG24692 [Drosophila erecta] >gi|190659980|gb...    95   2e-18
ref|XP_002001555.1| GI16246 [Drosophila mojavensis] >gi|19391213...    95   2e-18
gb|ACN88633.1| MIP07382p [Drosophila melanogaster]                     95   2e-18
ref|XP_395686.2| PREDICTED: similar to CG32226-PA [Apis mellifera]     94   3e-18
ref|XP_002125269.1| PREDICTED: similar to galectin-6 [Ciona inte...    94   4e-18
ref|XP_001901599.1| Galactoside-binding lectin family protein [B...    94   4e-18
gb|ABE98245.2| galectin-4-like [Oreochromis mossambicus]               94   5e-18
ref|XP_001656933.1| galectin [Aedes aegypti] >gi|108880962|gb|EA...    94   5e-18
ref|XP_001865727.1| 32 kDa beta-galactoside-binding lectin lec-3...    93   6e-18
emb|CAM15341.1| novel protein similar to lectin, galactoside-bin...    93   7e-18
ref|XP_421196.2| PREDICTED: hypothetical protein [Gallus gallus]       93   7e-18
ref|XP_318003.2| galectin (AGAP004806-PA) [Anopheles gambiae str...    93   8e-18
ref|XP_971732.1| PREDICTED: similar to galectin (AGAP008844-PA) ...    93   8e-18
ref|XP_002131573.1| PREDICTED: similar to Galectin-6 [Ciona inte...    93   8e-18
emb|CAD79473.1| galectin-4 (lectin, galactoside-binding, soluble...    92   1e-17
gb|AAF34676.1|AF222694_1 galectin-related inhibitor of prolifera...    92   1e-17
dbj|BAF75419.1| galectin [Crassostrea gigas]                           92   2e-17
ref|XP_001368937.1| PREDICTED: similar to galectin-4 [Monodelphi...    92   2e-17
ref|XP_512641.2| PREDICTED: similar to galectin-4 [Pan troglodytes]    91   3e-17
gb|ABG75998.1| galectin [Crassostrea virginica]                        91   3e-17
ref|XP_001513500.1| PREDICTED: similar to hCG1644106 [Ornithorhy...    90   7e-17
ref|XP_001679684.1| Hypothetical protein CBG02518 [Caenorhabditi...    89   9e-17
gb|EEB10608.1| conserved hypothetical protein [Pediculus humanus...    89   1e-16
ref|XP_001995998.1| GH14254 [Drosophila grimshawi] >gi|193891790...    89   2e-16
gb|AAD00843.1| Ov87 [Onchocerca volvulus]                              89   2e-16
emb|CAG10725.1| unnamed protein product [Tetraodon nigroviridis]       89   2e-16
ref|XP_001509441.1| PREDICTED: similar to olfactory receptor Olr...    88   3e-16
ref|NP_001038765.1| hypothetical protein LOC723995 [Danio rerio]...    88   3e-16
ref|NP_495163.1| gaLECtin family member (lec-5) [Caenorhabditis ...    87   4e-16

>ref|NP_001135409.1| galectin-1 [Papio anubis]
 gb|ABX74928.1| beta-galactoside-binding lectin precursor [Papio anubis]
 gb|ABX74929.1| beta-galactoside-binding lectin precursor [Macaca mulatta]
 gb|ABX74932.1| beta-galactoside-binding lectin precursor [Cercopithecus cephus]
 gb|ABX74933.1| beta-galactoside-binding lectin precursor [Colobus guereza]
 gb|ACA58296.1| beta-galactoside-binding lectin precursor [Cercopithecus nictitans]
          Length = 135

 Score =  194 bits (495), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 112/134 (83%), Positives = 118/134 (88%), Gaps = 6/134 (4%)

Query: 1   ACGLVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNN---LCNPRFNAHGDVNTIVC 57
           ACGLVASNLNLKPGECLRVRGEVA DAKSF+LNLGKD NN     NPRFNAHGD NTIVC
Sbjct: 2   ACGLVASNLNLKPGECLRVRGEVAPDAKSFVLNLGKDSNNLCLHFNPRFNAHGDANTIVC 61

Query: 58  NSKDAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYL 114
           NSKD GAWG EQRE+AFPFQPGSV EV   F+Q DLTIKLPDGYEFKFPNRLNLEAINY+
Sbjct: 62  NSKDGGAWGTEQREAAFPFQPGSVAEVCITFDQADLTIKLPDGYEFKFPNRLNLEAINYM 121

Query: 115 SAGGDFKIKCVAFE 128
           +A GDFKIKCVAF+
Sbjct: 122 AADGDFKIKCVAFD 135


>gb|ABX74931.1| beta-galactoside-binding lectin precursor [Varecia variegata]
          Length = 135

 Score =  194 bits (493), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 111/134 (82%), Positives = 117/134 (87%), Gaps = 6/134 (4%)

Query: 1   ACGLVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNN---LCNPRFNAHGDVNTIVC 57
           ACGLVASNLNLKPGECLRVRGEVA DAKSF+LNLGKD NN     NPRF+AHGD NTIVC
Sbjct: 2   ACGLVASNLNLKPGECLRVRGEVAPDAKSFVLNLGKDSNNLCLHFNPRFDAHGDANTIVC 61

Query: 58  NSKDAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYL 114
           NSKD GAWGAEQRESAFPFQPGSV EV   F+Q DLTI LPDGY FKFPNRLNLEAI+Y+
Sbjct: 62  NSKDGGAWGAEQRESAFPFQPGSVAEVCITFDQADLTITLPDGYAFKFPNRLNLEAISYM 121

Query: 115 SAGGDFKIKCVAFE 128
           +A GDFKIKCVAFE
Sbjct: 122 AADGDFKIKCVAFE 135


>sp|P81184|LEG1_SHEEP RecName: Full=Galectin-1; AltName: Full=Lectin galactoside-binding
           soluble 1; AltName: Full=Beta-galactoside-binding lectin
           L-14-I; Short=Lactose-binding lectin 1; AltName:
           Full=S-Lac lectin 1; AltName: Full=Galaptin; AltName:
           Full=14 kDa lectin; AltName: Full=OPG-1
          Length = 135

 Score =  194 bits (493), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 121/134 (90%), Positives = 123/134 (91%), Gaps = 6/134 (4%)

Query: 1   ACGLVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNN---LCNPRFNAHGDVNTIVC 57
           ACGLVASNLNLKPGECLRVRGEVAADAKSF LNLGKDDNN     NPRFNAHGD+NTIVC
Sbjct: 2   ACGLVASNLNLKPGECLRVRGEVAADAKSFSLNLGKDDNNLCLHFNPRFNAHGDINTIVC 61

Query: 58  NSKDAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYL 114
           NSKD GAWGAEQRE+AFPFQPGSV EV   FNQTDLTIKLPDGYEFKFPNRLNLEAINYL
Sbjct: 62  NSKDGGAWGAEQRETAFPFQPGSVAEVCISFNQTDLTIKLPDGYEFKFPNRLNLEAINYL 121

Query: 115 SAGGDFKIKCVAFE 128
           SAGGDFKIKCVAFE
Sbjct: 122 SAGGDFKIKCVAFE 135


>sp|P48538|LEG1_CRIGR RecName: Full=Galectin-1; AltName: Full=Lectin galactoside-binding
           soluble 1; AltName: Full=Beta-galactoside-binding lectin
           L-14-I; Short=Lactose-binding lectin 1; AltName:
           Full=S-Lac lectin 1; AltName: Full=Galaptin; AltName:
           Full=14 kDa lectin
 gb|AAA36995.1| 14 kDa beta-galactoside-binding lectin
          Length = 135

 Score =  193 bits (491), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 109/134 (81%), Positives = 116/134 (86%), Gaps = 6/134 (4%)

Query: 1   ACGLVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNN---LCNPRFNAHGDVNTIVC 57
           ACGLVASNLNLKPGECL+VRGEVA DAKSF+LNLGKD NN     NPRFNAHGD NTIVC
Sbjct: 2   ACGLVASNLNLKPGECLKVRGEVAPDAKSFVLNLGKDSNNLCLHFNPRFNAHGDANTIVC 61

Query: 58  NSKDAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYL 114
           NSKD GAWG E RE AFPFQPGS VEV   F+Q DLTIKLPDG+EFKFPNRLN+EAINY+
Sbjct: 62  NSKDNGAWGTEHREPAFPFQPGSTVEVCITFDQADLTIKLPDGHEFKFPNRLNMEAINYM 121

Query: 115 SAGGDFKIKCVAFE 128
           +A GDFKIKCVAFE
Sbjct: 122 AADGDFKIKCVAFE 135


>ref|XP_001083427.1| PREDICTED: lectin, galactoside-binding, soluble, 1 (galectin 1)
           isoform 2 [Macaca mulatta]
          Length = 135

 Score =  193 bits (491), Expect = 5e-48,   Method: Composition-based stats.
 Identities = 111/134 (82%), Positives = 117/134 (87%), Gaps = 6/134 (4%)

Query: 1   ACGLVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNN---LCNPRFNAHGDVNTIVC 57
           ACGLVASNLNLKPGECLRVRGEVA DAKSF+LNLGKD NN     NPRFNA GD NTIVC
Sbjct: 2   ACGLVASNLNLKPGECLRVRGEVAPDAKSFVLNLGKDSNNLCLHFNPRFNAQGDANTIVC 61

Query: 58  NSKDAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYL 114
           NSKD GAWG EQRE+AFPFQPGSV EV   F+Q DLTIKLPDGYEFKFPNRLNLEAINY+
Sbjct: 62  NSKDGGAWGTEQREAAFPFQPGSVAEVCITFDQADLTIKLPDGYEFKFPNRLNLEAINYM 121

Query: 115 SAGGDFKIKCVAFE 128
           +A GDFKIKCVAF+
Sbjct: 122 AADGDFKIKCVAFD 135


>ref|NP_063969.1| lectin, galactoside-binding, soluble, 1 [Rattus norvegicus]
 sp|P11762|LEG1_RAT RecName: Full=Galectin-1; AltName: Full=Lectin galactoside-binding
           soluble 1; AltName: Full=Beta-galactoside-binding lectin
           L-14-I; Short=Lactose-binding lectin 1; AltName:
           Full=S-Lac lectin 1; AltName: Full=Galaptin; AltName:
           Full=14 kDa lectin; AltName: Full=RL 14.5
 gb|AAA40822.1| beta-galactoside-binding protein
 gb|AAH58476.1| Lectin, galactoside-binding, soluble, 1 [Rattus norvegicus]
 gb|EDM15838.1| lectin, galactose binding, soluble 1 [Rattus norvegicus]
          Length = 135

 Score =  193 bits (491), Expect = 5e-48,   Method: Composition-based stats.
 Identities = 107/134 (79%), Positives = 117/134 (87%), Gaps = 6/134 (4%)

Query: 1   ACGLVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNN---LCNPRFNAHGDVNTIVC 57
           ACGLVASNLNLKPGECL+VRGE+A DAKSF+LNLGKD NN     NPRFNAHGD NTIVC
Sbjct: 2   ACGLVASNLNLKPGECLKVRGELAPDAKSFVLNLGKDSNNLCLHFNPRFNAHGDANTIVC 61

Query: 58  NSKDAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYL 114
           NSKD G WG EQRE+AFPFQPGS+ EV   F+Q DLTIKLPDG+EFKFPNRLN+EAINY+
Sbjct: 62  NSKDDGTWGTEQRETAFPFQPGSITEVCITFDQADLTIKLPDGHEFKFPNRLNMEAINYM 121

Query: 115 SAGGDFKIKCVAFE 128
           +A GDFKIKCVAFE
Sbjct: 122 AADGDFKIKCVAFE 135


>ref|XP_001501082.1| PREDICTED: similar to Galectin-1 (Lectin galactoside-binding
           soluble 1) (Beta-galactoside-binding lectin L-14-I)
           (Lactose-binding lectin 1) (S-Lac lectin 1) (Galaptin)
           (14 kDa lectin) (HPL) (HBL) (Putative MAPK-activating
           protein PM12) [Equus caballus]
          Length = 135

 Score =  192 bits (490), Expect = 6e-48,   Method: Composition-based stats.
 Identities = 110/134 (82%), Positives = 116/134 (86%), Gaps = 6/134 (4%)

Query: 1   ACGLVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNN---LCNPRFNAHGDVNTIVC 57
           ACGLVASNLNLKPGECLRVRGEVA DAKSF+LNLGKD +N     NPRFN HGD NTIVC
Sbjct: 2   ACGLVASNLNLKPGECLRVRGEVAPDAKSFVLNLGKDSDNLCLHFNPRFNMHGDANTIVC 61

Query: 58  NSKDAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYL 114
           NSKD GAWG EQRESAFPFQPGSV+EV   F++ DLTI LPDGY FKFPNRLNLEA+NYL
Sbjct: 62  NSKDGGAWGTEQRESAFPFQPGSVMEVCISFDKADLTITLPDGYSFKFPNRLNLEAVNYL 121

Query: 115 SAGGDFKIKCVAFE 128
           SA GDFKIKCVAFE
Sbjct: 122 SANGDFKIKCVAFE 135


>gb|AAH02063.1| Lectin, galactose binding, soluble 1 [Mus musculus]
          Length = 135

 Score =  192 bits (490), Expect = 7e-48,   Method: Composition-based stats.
 Identities = 105/134 (78%), Positives = 117/134 (87%), Gaps = 6/134 (4%)

Query: 1   ACGLVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNN---LCNPRFNAHGDVNTIVC 57
           ACGLVASNLNLKPGECL+VRGEVA+DAKSF+LNLGKD NN     NPRFNAHGD NTIVC
Sbjct: 2   ACGLVASNLNLKPGECLKVRGEVASDAKSFVLNLGKDSNNLCLHFNPRFNAHGDANTIVC 61

Query: 58  NSKDAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYL 114
           N+K+ G WG E RE AFPFQPGS++EV   F+Q DLTIKLPDG+EFKFPNRLN+EAINY+
Sbjct: 62  NTKEDGTWGTEHREPAFPFQPGSIIEVCITFDQADLTIKLPDGHEFKFPNRLNMEAINYM 121

Query: 115 SAGGDFKIKCVAFE 128
           +A GDFKIKCVAFE
Sbjct: 122 AADGDFKIKCVAFE 135


>ref|NP_786976.1| galectin-1 [Bos taurus]
 sp|P11116|LEG1_BOVIN RecName: Full=Galectin-1; AltName: Full=Lectin galactoside-binding
           soluble 1; AltName: Full=Beta-galactoside-binding lectin
           L-14-I; Short=Lactose-binding lectin 1; AltName:
           Full=S-Lac lectin 1; AltName: Full=Galaptin; AltName:
           Full=14 kDa lectin
 emb|CAA32508.1| unnamed protein product [Bos taurus]
 dbj|BAC56529.1| similar to galactose-binding lectin [Bos taurus]
 gb|AAI03157.1| Lectin, galactoside-binding, soluble, 1 [Bos taurus]
          Length = 135

 Score =  192 bits (489), Expect = 8e-48,   Method: Composition-based stats.
 Identities = 126/134 (94%), Positives = 126/134 (94%), Gaps = 6/134 (4%)

Query: 1   ACGLVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNN---LCNPRFNAHGDVNTIVC 57
           ACGLVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNN     NPRFNAHGDVNTIVC
Sbjct: 2   ACGLVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNLCLHFNPRFNAHGDVNTIVC 61

Query: 58  NSKDAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYL 114
           NSKDAGAWGAEQRESAFPFQPGSVVEV   FNQTDLTIKLPDGYEFKFPNRLNLEAINYL
Sbjct: 62  NSKDAGAWGAEQRESAFPFQPGSVVEVCISFNQTDLTIKLPDGYEFKFPNRLNLEAINYL 121

Query: 115 SAGGDFKIKCVAFE 128
           SAGGDFKIKCVAFE
Sbjct: 122 SAGGDFKIKCVAFE 135


>ref|NP_032521.1| lectin, galactose binding, soluble 1 [Mus musculus]
 sp|P16045|LEG1_MOUSE RecName: Full=Galectin-1; AltName: Full=Lectin galactoside-binding
           soluble 1; AltName: Full=Beta-galactoside-binding lectin
           L-14-I; Short=Lactose-binding lectin 1; AltName:
           Full=S-Lac lectin 1; AltName: Full=Galaptin; AltName:
           Full=14 kDa lectin
 emb|CAA37242.1| unnamed protein product [Mus musculus]
 emb|CAA34117.1| unnamed protein product [Mus musculus]
 emb|CAA47143.1| L14 lectin [Mus musculus]
 emb|CAA35930.1| betagalactoside binding protein [Mus musculus]
 gb|AAH99479.1| Lectin, galactose binding, soluble 1 [Mus musculus]
          Length = 135

 Score =  192 bits (488), Expect = 9e-48,   Method: Composition-based stats.
 Identities = 105/134 (78%), Positives = 116/134 (86%), Gaps = 6/134 (4%)

Query: 1   ACGLVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNN---LCNPRFNAHGDVNTIVC 57
           ACGLVASNLNLKPGECL+VRGEVA+DAKSF+LNLGKD NN     NPRFNAHGD NTIVC
Sbjct: 2   ACGLVASNLNLKPGECLKVRGEVASDAKSFVLNLGKDSNNLCLHFNPRFNAHGDANTIVC 61

Query: 58  NSKDAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYL 114
           N+K+ G WG E RE AFPFQPGS+ EV   F+Q DLTIKLPDG+EFKFPNRLN+EAINY+
Sbjct: 62  NTKEDGTWGTEHREPAFPFQPGSITEVCITFDQADLTIKLPDGHEFKFPNRLNMEAINYM 121

Query: 115 SAGGDFKIKCVAFE 128
           +A GDFKIKCVAFE
Sbjct: 122 AADGDFKIKCVAFE 135


>pdb|1SLA|A Chain A, X-Ray Crystallography Reveals Crosslinking Of Mammalian
           Lectin (Galectin-1) By Biantennary Complex Type
           Saccharides
 pdb|1SLA|B Chain B, X-Ray Crystallography Reveals Crosslinking Of Mammalian
           Lectin (Galectin-1) By Biantennary Complex Type
           Saccharides
 pdb|1SLB|A Chain A, X-Ray Crystallography Reveals Crosslinking Of Mammalian
           Lectin (Galectin-1) By Biantennary Complex Type
           Saccharides
 pdb|1SLB|B Chain B, X-Ray Crystallography Reveals Crosslinking Of Mammalian
           Lectin (Galectin-1) By Biantennary Complex Type
           Saccharides
 pdb|1SLB|C Chain C, X-Ray Crystallography Reveals Crosslinking Of Mammalian
           Lectin (Galectin-1) By Biantennary Complex Type
           Saccharides
 pdb|1SLB|D Chain D, X-Ray Crystallography Reveals Crosslinking Of Mammalian
           Lectin (Galectin-1) By Biantennary Complex Type
           Saccharides
 pdb|1SLC|A Chain A, X-Ray Crystallography Reveals Crosslinking Of Mammalian
           Lectin (Galectin-1) By Biantennary Complex Type
           Saccharides
 pdb|1SLC|B Chain B, X-Ray Crystallography Reveals Crosslinking Of Mammalian
           Lectin (Galectin-1) By Biantennary Complex Type
           Saccharides
 pdb|1SLC|C Chain C, X-Ray Crystallography Reveals Crosslinking Of Mammalian
           Lectin (Galectin-1) By Biantennary Complex Type
           Saccharides
 pdb|1SLC|D Chain D, X-Ray Crystallography Reveals Crosslinking Of Mammalian
           Lectin (Galectin-1) By Biantennary Complex Type
           Saccharides
 pdb|1SLT|A Chain A, Structure Of S-Lectin, A Developmentally Regulated
           Vertebrate Beta-Galactoside Binding Protein
 pdb|1SLT|B Chain B, Structure Of S-Lectin, A Developmentally Regulated
           Vertebrate Beta-Galactoside Binding Protein
 gb|AAB22210.1| beta-galactoside-binding lectin [cattle, heart, Peptide, 134 aa]
          Length = 134

 Score =  192 bits (488), Expect = 9e-48,   Method: Composition-based stats.
 Identities = 126/134 (94%), Positives = 126/134 (94%), Gaps = 6/134 (4%)

Query: 1   ACGLVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNN---LCNPRFNAHGDVNTIVC 57
           ACGLVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNN     NPRFNAHGDVNTIVC
Sbjct: 1   ACGLVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNLCLHFNPRFNAHGDVNTIVC 60

Query: 58  NSKDAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYL 114
           NSKDAGAWGAEQRESAFPFQPGSVVEV   FNQTDLTIKLPDGYEFKFPNRLNLEAINYL
Sbjct: 61  NSKDAGAWGAEQRESAFPFQPGSVVEVCISFNQTDLTIKLPDGYEFKFPNRLNLEAINYL 120

Query: 115 SAGGDFKIKCVAFE 128
           SAGGDFKIKCVAFE
Sbjct: 121 SAGGDFKIKCVAFE 134


>gb|ABX74930.1| beta-galactoside-binding lectin precursor [Ateles fusciceps]
          Length = 135

 Score =  192 bits (488), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 113/134 (84%), Positives = 118/134 (88%), Gaps = 6/134 (4%)

Query: 1   ACGLVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNN---LCNPRFNAHGDVNTIVC 57
           ACGL ASNLNLKPGECLRVRGEVA DAKSF+LNLGKD NN     NPRFNAHGD NTIVC
Sbjct: 2   ACGLEASNLNLKPGECLRVRGEVAPDAKSFVLNLGKDSNNLCLHFNPRFNAHGDANTIVC 61

Query: 58  NSKDAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYL 114
           NSKD GAWGAEQRE+AFPFQPGSV EV   FNQ DLTIKLPDGYEFKFPNRLNLEAINY+
Sbjct: 62  NSKDGGAWGAEQREAAFPFQPGSVAEVCISFNQADLTIKLPDGYEFKFPNRLNLEAINYM 121

Query: 115 SAGGDFKIKCVAFE 128
           +A GDFKIKCVAF+
Sbjct: 122 AADGDFKIKCVAFD 135


>gb|AAP36586.1| Homo sapiens lectin, galactoside-binding, soluble, 1 (galectin 1)
           [synthetic construct]
 gb|AAX43293.1| lectin galactoside-binding soluble 1 [synthetic construct]
 gb|AAX43294.1| lectin galactoside-binding soluble 1 [synthetic construct]
          Length = 136

 Score =  191 bits (486), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 109/134 (81%), Positives = 117/134 (87%), Gaps = 6/134 (4%)

Query: 1   ACGLVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNN---LCNPRFNAHGDVNTIVC 57
           ACGLVASNLNLKPGECLRVRGEVA DAKSF+LNLGKD NN     NPRFNAHGD NTIVC
Sbjct: 2   ACGLVASNLNLKPGECLRVRGEVAPDAKSFVLNLGKDSNNLCLHFNPRFNAHGDANTIVC 61

Query: 58  NSKDAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYL 114
           NSKD GAWG EQRE+ FPFQPGSV EV   F+Q +LT+KLPDGYEFKFPNRLNLEAINY+
Sbjct: 62  NSKDGGAWGTEQREAVFPFQPGSVAEVCITFDQANLTVKLPDGYEFKFPNRLNLEAINYM 121

Query: 115 SAGGDFKIKCVAFE 128
           +A GDFKIKCVAF+
Sbjct: 122 AADGDFKIKCVAFD 135


>ref|NP_002296.1| galectin-1 [Homo sapiens]
 ref|XP_001162066.1| PREDICTED: hypothetical protein isoform 2 [Pan troglodytes]
 ref|XP_001162104.1| PREDICTED: hypothetical protein isoform 3 [Pan troglodytes]
 sp|P09382|LEG1_HUMAN RecName: Full=Galectin-1; AltName: Full=Lectin galactoside-binding
           soluble 1; AltName: Full=Beta-galactoside-binding lectin
           L-14-I; Short=Lactose-binding lectin 1; AltName:
           Full=S-Lac lectin 1; AltName: Full=Galaptin; AltName:
           Full=14 kDa lectin; AltName: Full=HPL; AltName:
           Full=HBL; AltName: Full=Putative MAPK-activating protein
           PM12
 emb|CAA32938.1| unnamed protein product [Homo sapiens]
 gb|AAB00777.1| 14 kDa beta-galactoside-binding lectin [Homo sapiens]
 gb|AAA36170.1| lectin precursor
 emb|CAA33328.1| 14 kDa beta-galactoside-binding lectin [Homo sapiens]
 emb|CAB42897.1| lectin, galactoside-binding, soluble, 1 (galectin 1) [Homo sapiens]
 gb|AAH01693.1| Lectin, galactoside-binding, soluble, 1 [Homo sapiens]
 gb|AAH20675.1| Lectin, galactoside-binding, soluble, 1 [Homo sapiens]
 gb|AAP35421.1| lectin, galactoside-binding, soluble, 1 (galectin 1) [Homo sapiens]
 dbj|BAC77389.1| putative MAPK activating protein [Homo sapiens]
 emb|CAG30397.1| LGALS1 [Homo sapiens]
 gb|AAX41649.1| lectin galactoside-binding soluble 1 [synthetic construct]
 gb|AAX41650.1| lectin galactoside-binding soluble 1 [synthetic construct]
 emb|CAK54541.1| LGALS1 [synthetic construct]
 emb|CAK54840.1| LGALS1 [synthetic construct]
 emb|CAL37536.1| hypothetical protein [synthetic construct]
 gb|EAW60178.1| lectin, galactoside-binding, soluble, 1 (galectin 1) [Homo sapiens]
 gb|ABM83189.1| lectin, galactoside-binding, soluble, 1 (galectin 1) [synthetic
           construct]
 gb|ABM86391.1| lectin, galactoside-binding, soluble, 1 (galectin 1) [synthetic
           construct]
 gb|ACA58297.1| beta-galactoside-binding lectin precursor [Homo sapiens]
 dbj|BAG35095.1| unnamed protein product [Homo sapiens]
 dbj|BAG72608.1| lectin, galactoside-binding, soluble, 1 [synthetic construct]
          Length = 135

 Score =  190 bits (484), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 109/134 (81%), Positives = 117/134 (87%), Gaps = 6/134 (4%)

Query: 1   ACGLVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNN---LCNPRFNAHGDVNTIVC 57
           ACGLVASNLNLKPGECLRVRGEVA DAKSF+LNLGKD NN     NPRFNAHGD NTIVC
Sbjct: 2   ACGLVASNLNLKPGECLRVRGEVAPDAKSFVLNLGKDSNNLCLHFNPRFNAHGDANTIVC 61

Query: 58  NSKDAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYL 114
           NSKD GAWG EQRE+ FPFQPGSV EV   F+Q +LT+KLPDGYEFKFPNRLNLEAINY+
Sbjct: 62  NSKDGGAWGTEQREAVFPFQPGSVAEVCITFDQANLTVKLPDGYEFKFPNRLNLEAINYM 121

Query: 115 SAGGDFKIKCVAFE 128
           +A GDFKIKCVAF+
Sbjct: 122 AADGDFKIKCVAFD 135


>gb|AAA37667.1| beta-galactoside binding protein
          Length = 135

 Score =  190 bits (484), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 104/134 (77%), Positives = 115/134 (85%), Gaps = 6/134 (4%)

Query: 1   ACGLVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNN---LCNPRFNAHGDVNTIVC 57
           ACGLVASNLNLKPGECL+VRGEVA+DAKSF+LNLGKD NN     NPRFNAHGD NTIVC
Sbjct: 2   ACGLVASNLNLKPGECLKVRGEVASDAKSFVLNLGKDSNNLCLHFNPRFNAHGDANTIVC 61

Query: 58  NSKDAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYL 114
           N+K+ G WG E RE A PFQPGS+ EV   F+Q DLTIKLPDG+EFKFPNRLN+EAINY+
Sbjct: 62  NTKEDGTWGTEHREPASPFQPGSITEVCITFDQADLTIKLPDGHEFKFPNRLNMEAINYM 121

Query: 115 SAGGDFKIKCVAFE 128
           +A GDFKIKCVAFE
Sbjct: 122 AADGDFKIKCVAFE 135


>pdb|1GZW|B Chain B, X-Ray Crystal Structure Of Human Galectin-1
 prf||1713410A beta galactoside soluble lectin
 prf||1409286A beta galactoside binding lectin
          Length = 134

 Score =  190 bits (484), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 109/134 (81%), Positives = 117/134 (87%), Gaps = 6/134 (4%)

Query: 1   ACGLVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNN---LCNPRFNAHGDVNTIVC 57
           ACGLVASNLNLKPGECLRVRGEVA DAKSF+LNLGKD NN     NPRFNAHGD NTIVC
Sbjct: 1   ACGLVASNLNLKPGECLRVRGEVAPDAKSFVLNLGKDSNNLCLHFNPRFNAHGDANTIVC 60

Query: 58  NSKDAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYL 114
           NSKD GAWG EQRE+ FPFQPGSV EV   F+Q +LT+KLPDGYEFKFPNRLNLEAINY+
Sbjct: 61  NSKDGGAWGTEQREAVFPFQPGSVAEVCITFDQANLTVKLPDGYEFKFPNRLNLEAINYM 120

Query: 115 SAGGDFKIKCVAFE 128
           +A GDFKIKCVAF+
Sbjct: 121 AADGDFKIKCVAFD 134


>sp|Q49I35|LEG1_PIG RecName: Full=Galectin-1; AltName: Full=Lectin galactoside-binding
           soluble 1
 gb|AAX85355.1| lectin galactoside-binding soluble 1 [Sus scrofa]
          Length = 135

 Score =  189 bits (482), Expect = 6e-47,   Method: Composition-based stats.
 Identities = 112/134 (83%), Positives = 118/134 (88%), Gaps = 6/134 (4%)

Query: 1   ACGLVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNN---LCNPRFNAHGDVNTIVC 57
           ACGLVASNLNLKPGECL+VRGEVA DAKSF+LNLGKD NN     NPRF+ HGD+NTIVC
Sbjct: 2   ACGLVASNLNLKPGECLKVRGEVAPDAKSFVLNLGKDSNNLCLHFNPRFDMHGDINTIVC 61

Query: 58  NSKDAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYL 114
           NSKD GAWGAEQRESAFPFQPGSVVEV   F QTDLTIKLPDGYEF FPNRLNLEAI +L
Sbjct: 62  NSKDGGAWGAEQRESAFPFQPGSVVEVCISFGQTDLTIKLPDGYEFSFPNRLNLEAIEHL 121

Query: 115 SAGGDFKIKCVAFE 128
           +A GDFKIKCVAFE
Sbjct: 122 AADGDFKIKCVAFE 135


>gb|ABE01403.1| galectin 1 [Sus scrofa]
          Length = 135

 Score =  188 bits (479), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 112/134 (83%), Positives = 117/134 (87%), Gaps = 6/134 (4%)

Query: 1   ACGLVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNN---LCNPRFNAHGDVNTIVC 57
           ACGLVASNLNLKPGECL+VRGEVA DAKSF+LNLGKD NN     NPRF+ HGD+NTIVC
Sbjct: 2   ACGLVASNLNLKPGECLKVRGEVAPDAKSFVLNLGKDSNNLCLHFNPRFDMHGDINTIVC 61

Query: 58  NSKDAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYL 114
           NSKD GAWGAEQRESAFPFQPGSVVEV   F QTDLTIKLPDG EF FPNRLNLEAI YL
Sbjct: 62  NSKDGGAWGAEQRESAFPFQPGSVVEVCISFGQTDLTIKLPDGCEFSFPNRLNLEAIEYL 121

Query: 115 SAGGDFKIKCVAFE 128
           +A GDFKIKCVAFE
Sbjct: 122 AADGDFKIKCVAFE 135


>pdb|1GZW|A Chain A, X-Ray Crystal Structure Of Human Galectin-1
          Length = 134

 Score =  188 bits (478), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 108/134 (80%), Positives = 116/134 (86%), Gaps = 6/134 (4%)

Query: 1   ACGLVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNN---LCNPRFNAHGDVNTIVC 57
           ACGLVASNLNLKPGE LRVRGEVA DAKSF+LNLGKD NN     NPRFNAHGD NTIVC
Sbjct: 1   ACGLVASNLNLKPGEXLRVRGEVAPDAKSFVLNLGKDSNNLCLHFNPRFNAHGDANTIVC 60

Query: 58  NSKDAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYL 114
           NSKD GAWG EQRE+ FPFQPGSV EV   F+Q +LT+KLPDGYEFKFPNRLNLEAINY+
Sbjct: 61  NSKDGGAWGTEQREAVFPFQPGSVAEVCITFDQANLTVKLPDGYEFKFPNRLNLEAINYM 120

Query: 115 SAGGDFKIKCVAFE 128
           +A GDFKIKCVAF+
Sbjct: 121 AADGDFKIKCVAFD 134


>gb|AAT37622.1| galectin-1 [Sus scrofa]
          Length = 134

 Score =  188 bits (478), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 111/133 (83%), Positives = 116/133 (87%), Gaps = 6/133 (4%)

Query: 1   ACGLVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNN---LCNPRFNAHGDVNTIVC 57
           ACGLVASNLNLKPGECL+VRGEVA DAKSF+LNLGKD NN     NPRF+ HGD+NTIVC
Sbjct: 2   ACGLVASNLNLKPGECLKVRGEVAPDAKSFVLNLGKDSNNLCLHFNPRFDMHGDINTIVC 61

Query: 58  NSKDAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYL 114
           NSKD GAWGAEQRESAFPFQPGSVVEV   F  TDLTIKLPDGYEF FPNRLNLEAI YL
Sbjct: 62  NSKDGGAWGAEQRESAFPFQPGSVVEVCISFGHTDLTIKLPDGYEFSFPNRLNLEAIEYL 121

Query: 115 SAGGDFKIKCVAF 127
           +A GDFKIKCVAF
Sbjct: 122 AADGDFKIKCVAF 134


>ref|NP_001001867.1| galectin 1 [Sus scrofa]
 gb|ABD93885.1| galectin 1 [Sus scrofa]
          Length = 135

 Score =  187 bits (477), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 111/134 (82%), Positives = 116/134 (86%), Gaps = 6/134 (4%)

Query: 1   ACGLVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNN---LCNPRFNAHGDVNTIVC 57
           ACGLVASNLNLKPGECL+VRGEV  DAKSF+LNLGKD NN     NPRF+ HGD+NTIVC
Sbjct: 2   ACGLVASNLNLKPGECLKVRGEVTPDAKSFVLNLGKDSNNLCLHFNPRFDMHGDINTIVC 61

Query: 58  NSKDAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYL 114
           NSKD GAWGAEQRESAFPFQPGSVVEV   F QTDLTIKLPDG EF FPNRLNLEAI YL
Sbjct: 62  NSKDGGAWGAEQRESAFPFQPGSVVEVCISFGQTDLTIKLPDGCEFSFPNRLNLEAIEYL 121

Query: 115 SAGGDFKIKCVAFE 128
           +A GDFKIKCVAFE
Sbjct: 122 AADGDFKIKCVAFE 135


>pdb|1W6Q|B Chain B, X-Ray Crystal Structure Of R111h Human Galectin-1
          Length = 134

 Score =  187 bits (476), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 108/134 (80%), Positives = 116/134 (86%), Gaps = 6/134 (4%)

Query: 1   ACGLVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNN---LCNPRFNAHGDVNTIVC 57
           ACGLVASNLNLKPGECLRVRGEVA DAKSF+LNLGKD NN     NPRFNAHGD NTIVC
Sbjct: 1   ACGLVASNLNLKPGECLRVRGEVAPDAKSFVLNLGKDSNNLCLHFNPRFNAHGDANTIVC 60

Query: 58  NSKDAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYL 114
           NSKD GAWG EQRE+ FPFQPGSV EV   F+Q +LT+KLPDGYEFKFPN LNLEAINY+
Sbjct: 61  NSKDGGAWGTEQREAVFPFQPGSVAEVCITFDQANLTVKLPDGYEFKFPNHLNLEAINYM 120

Query: 115 SAGGDFKIKCVAFE 128
           +A GDFKIKCVAF+
Sbjct: 121 AADGDFKIKCVAFD 134


>ref|NP_001126310.1| lectin, galactoside-binding, soluble, 1 [Pongo abelii]
 sp|Q5R7M1|LEG1_PONAB RecName: Full=Galectin-1; AltName: Full=Lectin galactoside-binding
           soluble 1; AltName: Full=Beta-galactoside-binding lectin
           L-14-I; Short=Lactose-binding lectin 1; AltName:
           Full=S-Lac lectin 1; AltName: Full=Galaptin; AltName:
           Full=14 kDa lectin
 emb|CAH92239.1| hypothetical protein [Pongo abelii]
          Length = 135

 Score =  187 bits (476), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 109/134 (81%), Positives = 116/134 (86%), Gaps = 6/134 (4%)

Query: 1   ACGLVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNN---LCNPRFNAHGDVNTIVC 57
           ACGLVASNLNLKPGECLRVRGEV  DAKSF+LNLGK  NN     NPRFNAHGD NTIVC
Sbjct: 2   ACGLVASNLNLKPGECLRVRGEVTPDAKSFVLNLGKASNNLCLHFNPRFNAHGDANTIVC 61

Query: 58  NSKDAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYL 114
           NSKD GAWG EQRE+ FPFQPGSV EV   F+QT+LTIKLPDGYEFKFPNRLNLEAINY+
Sbjct: 62  NSKDGGAWGTEQREAVFPFQPGSVAEVCITFDQTNLTIKLPDGYEFKFPNRLNLEAINYM 121

Query: 115 SAGGDFKIKCVAFE 128
           +A GDFKIKCVAF+
Sbjct: 122 AADGDFKIKCVAFD 135


>pdb|1W6M|B Chain B, X-Ray Crystal Structure Of C2s Human Galectin-1 Complexed
           With Galactose
 pdb|1W6N|B Chain B, X-Ray Crystal Structure Of C2s Human Galectin-1
 pdb|1W6O|B Chain B, X-Ray Crystal Structure Of C2s Human Galectin-1 Complexed
           With Lactose
 pdb|1W6P|B Chain B, X-Ray Crystal Structure Of C2s Human Galectin-1 Complexed
           With N-Acetyl-Lactosamine
          Length = 134

 Score =  187 bits (475), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 108/134 (80%), Positives = 116/134 (86%), Gaps = 6/134 (4%)

Query: 1   ACGLVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNN---LCNPRFNAHGDVNTIVC 57
           A GLVASNLNLKPGECLRVRGEVA DAKSF+LNLGKD NN     NPRFNAHGD NTIVC
Sbjct: 1   ASGLVASNLNLKPGECLRVRGEVAPDAKSFVLNLGKDSNNLCLHFNPRFNAHGDANTIVC 60

Query: 58  NSKDAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYL 114
           NSKD GAWG EQRE+ FPFQPGSV EV   F+Q +LT+KLPDGYEFKFPNRLNLEAINY+
Sbjct: 61  NSKDDGAWGTEQREAVFPFQPGSVAEVCITFDQANLTVKLPDGYEFKFPNRLNLEAINYM 120

Query: 115 SAGGDFKIKCVAFE 128
           +A GDFKIKCVAF+
Sbjct: 121 AADGDFKIKCVAFD 134


>ref|NP_001009287.1| galectin 1 [Ovis aries]
 gb|AAT38511.1| galectin-1 [Ovis aries]
          Length = 136

 Score =  186 bits (474), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 120/135 (88%), Positives = 123/135 (91%), Gaps = 7/135 (5%)

Query: 1   AC-GLVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNN---LCNPRFNAHGDVNTIV 56
           AC GLVASNLNLKPGECLRVRGEVAADAKSF LNLGKDDNN     NPRF AHGD+NTIV
Sbjct: 2   ACQGLVASNLNLKPGECLRVRGEVAADAKSFSLNLGKDDNNLCLHFNPRFEAHGDINTIV 61

Query: 57  CNSKDAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINY 113
           CNSKDAGAWGAEQRESAFPFQPGSV EV   FN+TDLTIKLPDGYEFKFPNRLNLEAINY
Sbjct: 62  CNSKDAGAWGAEQRESAFPFQPGSVAEVCVSFNETDLTIKLPDGYEFKFPNRLNLEAINY 121

Query: 114 LSAGGDFKIKCVAFE 128
           L+AGGDFKIKCVAFE
Sbjct: 122 LAAGGDFKIKCVAFE 136


>ref|XP_001161991.1| PREDICTED: hypothetical protein isoform 1 [Pan troglodytes]
          Length = 128

 Score =  186 bits (474), Expect = 5e-46,   Method: Composition-based stats.
 Identities = 104/131 (79%), Positives = 112/131 (85%), Gaps = 7/131 (5%)

Query: 1   ACGLVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNN---LCNPRFNAHGDVNTIVC 57
           ACGLVASNLNLKPGECLRVRGEVA DAKSF+LNLGKD NN     NPRFNAHGD NTIVC
Sbjct: 2   ACGLVASNLNLKPGECLRVRGEVAPDAKSFVLNLGKDSNNLCLHFNPRFNAHGDANTIVC 61

Query: 58  NSKDAGAWGAEQRESAFPFQPGSVVEVFNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAG 117
           NSKD GAWG EQRE+ FPFQPGS      + +LT+KLPDGYEFKFPNRLNLEAINY++A 
Sbjct: 62  NSKDGGAWGTEQREAVFPFQPGS----VAEANLTVKLPDGYEFKFPNRLNLEAINYMAAD 117

Query: 118 GDFKIKCVAFE 128
           GDFKIKCVAF+
Sbjct: 118 GDFKIKCVAFD 128


>ref|XP_549042.2| PREDICTED: similar to Galectin-1 (Beta-galactoside-binding lectin
           L-14-I) (Lactose-binding lectin 1) (S-Lac lectin 1)
           (Galaptin) (14 kDa lectin) (HPL) (HBL) (MAPK activating
           protein MP12) [Canis familiaris]
          Length = 281

 Score =  186 bits (474), Expect = 5e-46,   Method: Composition-based stats.
 Identities = 99/134 (73%), Positives = 111/134 (82%), Gaps = 6/134 (4%)

Query: 1   ACGLVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNN---LCNPRFNAHGDVNTIVC 57
           ACGLVASNL+LKPG+CLRV+ EV  +AKSF+LNLGKD +N     NPRF AH DVNTIVC
Sbjct: 148 ACGLVASNLSLKPGQCLRVQCEVVPEAKSFVLNLGKDGDNLCLHFNPRFEAHSDVNTIVC 207

Query: 58  NSKDAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYL 114
           NSKD GA G E RESAFPFQPG+V EV   F+Q DLTIKLPDGY FKFPNRLNLEAI+YL
Sbjct: 208 NSKDGGARGEEHRESAFPFQPGTVTEVCISFDQADLTIKLPDGYTFKFPNRLNLEAISYL 267

Query: 115 SAGGDFKIKCVAFE 128
           +A GD KIKC+AF+
Sbjct: 268 AADGDMKIKCLAFD 281


>ref|XP_001083299.1| PREDICTED: lectin, galactoside-binding, soluble, 1 (galectin 1)
           isoform 1 [Macaca mulatta]
          Length = 125

 Score =  186 bits (474), Expect = 5e-46,   Method: Composition-based stats.
 Identities = 106/131 (80%), Positives = 111/131 (84%), Gaps = 10/131 (7%)

Query: 1   ACGLVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNN---LCNPRFNAHGDVNTIVC 57
           ACGLVASNLNLKPGECLRVRGEVA DAKSF+LNLGKD NN     NPRFNA GD NTIVC
Sbjct: 2   ACGLVASNLNLKPGECLRVRGEVAPDAKSFVLNLGKDSNNLCLHFNPRFNAQGDANTIVC 61

Query: 58  NSKDAGAWGAEQRESAFPFQPGSVVEVFNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAG 117
           NSKD GAWG EQRE+AFPFQPGS        DLTIKLPDGYEFKFPNRLNLEAINY++A 
Sbjct: 62  NSKDGGAWGTEQREAAFPFQPGSA-------DLTIKLPDGYEFKFPNRLNLEAINYMAAD 114

Query: 118 GDFKIKCVAFE 128
           GDFKIKCVAF+
Sbjct: 115 GDFKIKCVAFD 125


>ref|XP_852831.1| PREDICTED: similar to Galectin-1 (Beta-galactoside-binding lectin
           L-14-I) (Lactose-binding lectin 1) (S-Lac lectin 1)
           (Galaptin) (14 kDa lectin) (HPL) (HBL) (MAPK activating
           protein MP12) [Canis familiaris]
          Length = 135

 Score =  186 bits (473), Expect = 6e-46,   Method: Composition-based stats.
 Identities = 101/134 (75%), Positives = 113/134 (84%), Gaps = 6/134 (4%)

Query: 1   ACGLVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNN---LCNPRFNAHGDVNTIVC 57
           ACGLVASNL+LKPG+CLRV+ EV  +AKSF+LNLGKD +N     NPRF AHGDVNTIVC
Sbjct: 2   ACGLVASNLSLKPGQCLRVQCEVVPEAKSFVLNLGKDGDNLCLHFNPRFEAHGDVNTIVC 61

Query: 58  NSKDAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYL 114
           NSKD GAWG E RESAFPFQPG+V EV   F+Q DLTIKLPDGY FKFPNRLNLEAI+YL
Sbjct: 62  NSKDGGAWGEELRESAFPFQPGTVTEVCISFDQADLTIKLPDGYTFKFPNRLNLEAISYL 121

Query: 115 SAGGDFKIKCVAFE 128
           +A GD KIKC+AF+
Sbjct: 122 AADGDMKIKCLAFD 135


>pdb|1W6Q|A Chain A, X-Ray Crystal Structure Of R111h Human Galectin-1
          Length = 134

 Score =  185 bits (470), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 107/134 (79%), Positives = 115/134 (85%), Gaps = 6/134 (4%)

Query: 1   ACGLVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNN---LCNPRFNAHGDVNTIVC 57
           ACGLVASNLNLKPGE LRVRGEVA DAKSF+LNLGKD NN     NPRFNAHGD NTIVC
Sbjct: 1   ACGLVASNLNLKPGEXLRVRGEVAPDAKSFVLNLGKDSNNLCLHFNPRFNAHGDANTIVC 60

Query: 58  NSKDAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYL 114
           NSKD GAWG EQRE+ FPFQPGSV EV   F+Q +LT+KLPDGYEFKFPN LNLEAINY+
Sbjct: 61  NSKDGGAWGTEQREAVFPFQPGSVAEVCITFDQANLTVKLPDGYEFKFPNHLNLEAINYM 120

Query: 115 SAGGDFKIKCVAFE 128
           +A GDFKIKCVAF+
Sbjct: 121 AADGDFKIKCVAFD 134


>pdb|1W6M|A Chain A, X-Ray Crystal Structure Of C2s Human Galectin-1 Complexed
           With Galactose
 pdb|1W6N|A Chain A, X-Ray Crystal Structure Of C2s Human Galectin-1
 pdb|1W6O|A Chain A, X-Ray Crystal Structure Of C2s Human Galectin-1 Complexed
           With Lactose
 pdb|1W6P|A Chain A, X-Ray Crystal Structure Of C2s Human Galectin-1 Complexed
           With N-Acetyl-Lactosamine
          Length = 134

 Score =  185 bits (470), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 107/134 (79%), Positives = 115/134 (85%), Gaps = 6/134 (4%)

Query: 1   ACGLVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNN---LCNPRFNAHGDVNTIVC 57
           A GLVASNLNLKPGE LRVRGEVA DAKSF+LNLGKD NN     NPRFNAHGD NTIVC
Sbjct: 1   ASGLVASNLNLKPGEXLRVRGEVAPDAKSFVLNLGKDSNNLCLHFNPRFNAHGDANTIVC 60

Query: 58  NSKDAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYL 114
           NSKD GAWG EQRE+ FPFQPGSV EV   F+Q +LT+KLPDGYEFKFPNRLNLEAINY+
Sbjct: 61  NSKDDGAWGTEQREAVFPFQPGSVAEVCITFDQANLTVKLPDGYEFKFPNRLNLEAINYM 120

Query: 115 SAGGDFKIKCVAFE 128
           +A GDFKIKCVAF+
Sbjct: 121 AADGDFKIKCVAFD 134


>pdb|2ZKN|A Chain A, X-Ray Structure Of Mutant Galectin-1LACTOSE COMPLEX
 pdb|2ZKN|B Chain B, X-Ray Structure Of Mutant Galectin-1LACTOSE COMPLEX
          Length = 134

 Score =  181 bits (461), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 105/134 (78%), Positives = 113/134 (84%), Gaps = 6/134 (4%)

Query: 1   ACGLVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNN---LCNPRFNAHGDVNTIVC 57
           A GLVASNLNLKPGE LRVRGEVA DAKSF+LNLGKD NN     NPRFNAHGD NTIV 
Sbjct: 1   ASGLVASNLNLKPGESLRVRGEVAPDAKSFVLNLGKDSNNLSLHFNPRFNAHGDANTIVS 60

Query: 58  NSKDAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYL 114
           NSKD GAWG EQRE+ FPFQPGSV EV   F+Q +LT+KLPDGYEFKFPNRLNLEAINY+
Sbjct: 61  NSKDGGAWGTEQREAVFPFQPGSVAEVSITFDQANLTVKLPDGYEFKFPNRLNLEAINYM 120

Query: 115 SAGGDFKIKCVAFE 128
           +A GDFKIK VAF+
Sbjct: 121 AADGDFKIKSVAFD 134


>ref|XP_001510347.1| PREDICTED: similar to Galectin-1 (Lectin galactoside-binding
           soluble 1) (Beta-galactoside-binding lectin L-14-I)
           (Lactose-binding lectin 1) (S-Lac lectin 1) (Galaptin)
           (14 kDa lectin) (RL 14.5) [Ornithorhynchus anatinus]
          Length = 249

 Score =  180 bits (459), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 96/132 (72%), Positives = 110/132 (83%), Gaps = 6/132 (4%)

Query: 3   GLVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNN---LCNPRFNAHGDVNTIVCNS 59
           GLVA+NLNLK GEC++V+G+VA  AKSF+LNLGKD+ N     NPRF+ HGDVNTIVCNS
Sbjct: 118 GLVATNLNLKAGECVKVKGDVAPGAKSFVLNLGKDNANLCLHFNPRFDIHGDVNTIVCNS 177

Query: 60  KDAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYLSA 116
           KD G WG EQRE+AFPF PGS  EV   F+QT+LT+KLPDG  FKFPNRLNL+AINYL+A
Sbjct: 178 KDEGVWGKEQRETAFPFLPGSPAEVCVSFDQTELTVKLPDGQAFKFPNRLNLDAINYLAA 237

Query: 117 GGDFKIKCVAFE 128
            GDFKIKCVAFE
Sbjct: 238 EGDFKIKCVAFE 249


>ref|XP_001376589.1| PREDICTED: similar to Chain B, X-Ray Crystal Structure Of C2s Human
           Galectin-1 Complexed With Galactose [Monodelphis
           domestica]
          Length = 209

 Score =  165 bits (420), Expect = 7e-40,   Method: Composition-based stats.
 Identities = 79/131 (60%), Positives = 97/131 (74%), Gaps = 6/131 (4%)

Query: 4   LVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNN---LCNPRFNAHGDVNTIVCNSK 60
           ++ASNLNLKPG C+R+ G+V  DAKSF LNLGKD  N     NPRF+   D N IVCNS+
Sbjct: 79  ILASNLNLKPGVCVRIVGDVLPDAKSFRLNLGKDHENLALHFNPRFDCFDDTNVIVCNSR 138

Query: 61  DAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAG 117
             G+WGAEQRE++FPF PGS VEV   F  +  T++LPDG EFKFPNRLNL+ IN+L A 
Sbjct: 139 QEGSWGAEQRETSFPFLPGSQVEVCFAFEGSHFTVRLPDGSEFKFPNRLNLDTINFLEAN 198

Query: 118 GDFKIKCVAFE 128
           GDFK++ V F+
Sbjct: 199 GDFKLRSVNFD 209


>ref|XP_002195307.1| PREDICTED: galectin CG-16 [Taeniopygia guttata]
          Length = 134

 Score =  160 bits (407), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 68/131 (51%), Positives = 96/131 (73%), Gaps = 7/131 (5%)

Query: 3   GLVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNN---LCNPRFNAHGDVNTIVCNS 59
           GLV + L+++PGEC++V+G++ +DAK F +N+GKD N      NPRF+ HGDVNT+VCNS
Sbjct: 4   GLVVTQLDVEPGECIKVKGKIQSDAKGFAVNVGKDSNTLMLHFNPRFDCHGDVNTVVCNS 63

Query: 60  KDAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYLSA 116
           K+ G WG E R++ FPFQ G  +E+   F++T+ T+KLP+   FKFPNRL +E I YL+ 
Sbjct: 64  KEDGVWGEEDRKAEFPFQHGDKIEICISFDETEATVKLPEAE-FKFPNRLGMEKIEYLAV 122

Query: 117 GGDFKIKCVAF 127
            GDFK+K + F
Sbjct: 123 EGDFKVKAIKF 133


>ref|NP_996788.1| galectin CG-16 [Gallus gallus]
 sp|P23668|LEG6_CHICK RecName: Full=16 kDa beta-galactoside-binding lectin; AltName:
           Full=C-16; AltName: Full=Galectin CG-16
 gb|AAS59560.1| galectin CG-16 [Gallus gallus]
          Length = 134

 Score =  160 bits (407), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 64/131 (48%), Positives = 94/131 (71%), Gaps = 7/131 (5%)

Query: 3   GLVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNN---LCNPRFNAHGDVNTIVCNS 59
           GLV + L+++PGEC++V+G++ +DAK F +N+GKD +      NPRF+ HGDVNT+VCNS
Sbjct: 4   GLVVTQLDVQPGECVKVKGKILSDAKGFSVNVGKDSSTLMLHFNPRFDCHGDVNTVVCNS 63

Query: 60  KDAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYLSA 116
           K+ G WG E R++ FPFQ G  VE+   F+  ++ +K+P+   F+FPNRL +E I YL+ 
Sbjct: 64  KEDGTWGEEDRKADFPFQQGDKVEICISFDAAEVKVKVPEVE-FEFPNRLGMEKIQYLAV 122

Query: 117 GGDFKIKCVAF 127
            GDFK+K + F
Sbjct: 123 EGDFKVKAIKF 133


>pdb|1QMJ|A Chain A, Cg-16, A Homodimeric Agglutinin From Chicken Liver
 pdb|1QMJ|B Chain B, Cg-16, A Homodimeric Agglutinin From Chicken Liver
          Length = 132

 Score =  160 bits (406), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 64/131 (48%), Positives = 94/131 (71%), Gaps = 7/131 (5%)

Query: 3   GLVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNN---LCNPRFNAHGDVNTIVCNS 59
           GLV + L+++PGEC++V+G++ +DAK F +N+GKD +      NPRF+ HGDVNT+VCNS
Sbjct: 2   GLVVTQLDVQPGECVKVKGKILSDAKGFSVNVGKDSSTLMLHFNPRFDCHGDVNTVVCNS 61

Query: 60  KDAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYLSA 116
           K+ G WG E R++ FPFQ G  VE+   F+  ++ +K+P+   F+FPNRL +E I YL+ 
Sbjct: 62  KEDGTWGEEDRKADFPFQQGDKVEICISFDAAEVKVKVPEVE-FEFPNRLGMEKIQYLAV 120

Query: 117 GGDFKIKCVAF 127
            GDFK+K + F
Sbjct: 121 EGDFKVKAIKF 131


>ref|NP_990826.1| galectin-1 [Gallus gallus]
 sp|P07583|LEG4_CHICK RecName: Full=Beta-galactoside-binding lectin; AltName: Full=14 kDa
           lectin; AltName: Full=C-14
 gb|AAA48779.1| 14K beta-galactoside-binding lectin
 dbj|BAA00214.1| 14K beta-galactoside-binding lectin [Gallus gallus]
 prf||1410238A beta galactoside binding lectin
          Length = 135

 Score =  158 bits (400), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 69/132 (52%), Positives = 90/132 (68%), Gaps = 7/132 (5%)

Query: 3   GLVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDD---NNLCNPRFNAHGDVNTIVCNS 59
           G V +NL LKPG+ L V+G +A +AKSF++NLGKD        NPRF+AHGDVN IVCNS
Sbjct: 5   GPVCTNLGLKPGQRLTVKGIIAPNAKSFVMNLGKDSTHLGLHFNPRFDAHGDVNLIVCNS 64

Query: 60  KDAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYLSA 116
           K    WG EQRE+ FPFQ G+ +E+    N +DLT+ LP G++F FPNRL L   +Y   
Sbjct: 65  KKMEEWGTEQRETVFPFQKGAPIEITFSINPSDLTVHLP-GHQFSFPNRLGLSVFDYFDT 123

Query: 117 GGDFKIKCVAFE 128
            GDF ++ V++E
Sbjct: 124 HGDFTLRSVSWE 135


>prf||1304250A lectin,beta galactoside binding
          Length = 134

 Score =  158 bits (400), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 69/132 (52%), Positives = 90/132 (68%), Gaps = 7/132 (5%)

Query: 3   GLVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDD---NNLCNPRFNAHGDVNTIVCNS 59
           G V +NL LKPG+ L V+G +A +AKSF++NLGKD        NPRF+AHGDVN IVCNS
Sbjct: 4   GPVCTNLGLKPGQRLTVKGIIAPNAKSFVMNLGKDSTHLGLHFNPRFDAHGDVNLIVCNS 63

Query: 60  KDAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYLSA 116
           K    WG EQRE+ FPFQ G+ +E+    N +DLT+ LP G++F FPNRL L   +Y   
Sbjct: 64  KKMEEWGTEQRETVFPFQKGAPIEITFSINPSDLTVHLP-GHQFSFPNRLGLSVFDYFDT 122

Query: 117 GGDFKIKCVAFE 128
            GDF ++ V++E
Sbjct: 123 HGDFTLRSVSWE 134


>gb|ACH44734.1| putative galectin CG-16 [Taeniopygia guttata]
          Length = 134

 Score =  155 bits (393), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 67/131 (51%), Positives = 93/131 (70%), Gaps = 7/131 (5%)

Query: 3   GLVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNN---LCNPRFNAHGDVNTIVCNS 59
           GLV    +++PGEC++V+G++ +DAK F +N+GKD N      NPRF+ HGDVNTIVCNS
Sbjct: 4   GLVVIQRDVEPGECIKVKGKIQSDAKGFAVNVGKDSNTLMLHFNPRFDCHGDVNTIVCNS 63

Query: 60  KDAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYLSA 116
           K+ G WG E R++ FPFQ G  +E+   F++ + T+KLP+   FKFPNRL +E I YL+ 
Sbjct: 64  KEDGVWGEEDRKADFPFQHGDKIEICISFDEAEATVKLPEAE-FKFPNRLGMEKIEYLAV 122

Query: 117 GGDFKIKCVAF 127
            GDFK+K + F
Sbjct: 123 EGDFKVKAIKF 133


>gb|ABW04130.1| galactoside binding lectin [Epinephelus coioides]
          Length = 133

 Score =  154 bits (391), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 49/131 (37%), Positives = 74/131 (56%), Gaps = 5/131 (3%)

Query: 3   GLVASNLNLKPGECLRVRGEVAADAKSFLLNLG--KDDNNLCNPRFNAHGDVNTIVCNSK 60
            +V  N++ K G+ + + G V  +A +F +N+G  +D     NPRF+AHGD  T+VCNS 
Sbjct: 3   AVVMKNMSFKAGQTMTITGMVNPNATNFAINIGHEQDIALHVNPRFDAHGDQRTVVCNSY 62

Query: 61  DAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAG 117
             G W  E R+S+FPFQ G   +V   FN  +  + LPDG   +FPNRL      ++   
Sbjct: 63  QGGKWCEEVRDSSFPFQLGKEFKVIITFNAQEFQVSLPDGSVVRFPNRLGDTKYRHMKFE 122

Query: 118 GDFKIKCVAFE 128
           GD +I+ +  +
Sbjct: 123 GDARIQAIEIK 133


>dbj|BAC56336.1| similar to galactose-binding lectin [Bos taurus]
          Length = 114

 Score =  154 bits (389), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 104/114 (91%), Positives = 104/114 (91%), Gaps = 6/114 (5%)

Query: 21  GEVAADAKSFLLNLGKDDNN---LCNPRFNAHGDVNTIVCNSKDAGAWGAEQRESAFPFQ 77
           G  AADAKSFLLNLGKDDNN     NPRFNAHGDVNTIVCNSKDAGAWGAEQRESAFPFQ
Sbjct: 1   GRGAADAKSFLLNLGKDDNNLCLHFNPRFNAHGDVNTIVCNSKDAGAWGAEQRESAFPFQ 60

Query: 78  PGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFKIKCVAFE 128
           PGSVVEV   FNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFKIKCVAFE
Sbjct: 61  PGSVVEVCISFNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFKIKCVAFE 114


>ref|NP_001079039.1| galectin-Ia [Xenopus laevis]
 dbj|BAB83247.1| galectin family xgalectin-Ia [Xenopus laevis]
 gb|AAI28963.1| Lgalsia-a protein [Xenopus laevis]
          Length = 134

 Score =  153 bits (387), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 61/133 (45%), Positives = 84/133 (63%), Gaps = 7/133 (5%)

Query: 1   ACGLVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNN---LCNPRFNAHGDVNTIVC 57
           + G+V SN +LK G CL ++G +  DAKSF +NLGKD +N     NPRF+ HGD N I+C
Sbjct: 2   SAGMVMSNFSLKQGHCLELKGIIPKDAKSFAINLGKDSSNYVIHFNPRFDHHGDTNKIIC 61

Query: 58  NSKDAGAWGAEQRESAFPFQPGSVVEVFNQ---TDLTIKLPDGYEFKFPNRLNLEAINYL 114
           NSK+   WG EQRE+AFPFQ G+   +  +     L +KL DG EF FP R+ L+ I +L
Sbjct: 62  NSKEENHWGKEQRENAFPFQQGAETTICFEYQADHLKVKLSDGKEFNFPIRMPLDTITFL 121

Query: 115 SAGGDFKIKCVAF 127
           +  G  ++K  + 
Sbjct: 122 TMDG-IELKSFSL 133


>emb|CAA36183.1| unnamed protein product [Mus musculus]
          Length = 107

 Score =  152 bits (386), Expect = 7e-36,   Method: Composition-based stats.
 Identities = 81/106 (76%), Positives = 89/106 (83%), Gaps = 6/106 (5%)

Query: 1   ACGLVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNN---LCNPRFNAHGDVNTIVC 57
           ACGLVASNLNLKPGECL+VRGEVA+DAKSF+LNLGKD NN     NPRFNAHGD NTIVC
Sbjct: 2   ACGLVASNLNLKPGECLKVRGEVASDAKSFVLNLGKDSNNLCLHFNPRFNAHGDANTIVC 61

Query: 58  NSKDAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEF 100
           N+K+ G WG E RE AFPFQPGS+ EV   F+Q DLTIKLPDG+EF
Sbjct: 62  NTKEDGTWGTEHREPAFPFQPGSITEVCITFDQADLTIKLPDGHEF 107


>ref|NP_001079744.1| hypothetical protein LOC379433 [Xenopus laevis]
 gb|AAK11514.1| galectin-1 [Xenopus laevis]
 dbj|BAB83256.1| galectin family xgalectin-Ib [Xenopus laevis]
 gb|AAH53816.1| MGC64502 protein [Xenopus laevis]
          Length = 134

 Score =  152 bits (384), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 60/133 (45%), Positives = 84/133 (63%), Gaps = 7/133 (5%)

Query: 1   ACGLVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNN---LCNPRFNAHGDVNTIVC 57
           A G+V +N +LK G CL ++G +  DAKSF +NLGKD +N     NPRF+  GD N I+C
Sbjct: 2   AAGMVMNNFSLKQGHCLELKGFIPKDAKSFAINLGKDSSNYVIHFNPRFDHEGDTNKIIC 61

Query: 58  NSKDAGAWGAEQRESAFPFQPGSVVEVFNQ---TDLTIKLPDGYEFKFPNRLNLEAINYL 114
           NSK+  +WG EQRE+ FPFQ G+   +  +     L +KL DG EF FP R+ L+ I +L
Sbjct: 62  NSKEENSWGTEQRENVFPFQQGAETSICFEYQADHLKVKLSDGQEFNFPIRMPLDTITFL 121

Query: 115 SAGGDFKIKCVAF 127
           S  G  ++K ++ 
Sbjct: 122 SMDG-IELKAISL 133


>ref|NP_001134631.1| Beta-galactoside-binding lectin [Salmo salar]
 gb|ACI66975.1| Beta-galactoside-binding lectin [Salmo salar]
 gb|ACI67261.1| Beta-galactoside-binding lectin [Salmo salar]
 gb|ACI68081.1| Beta-galactoside-binding lectin [Salmo salar]
 gb|ACI68276.1| Beta-galactoside-binding lectin [Salmo salar]
 gb|ACM08630.1| Beta-galactoside-binding lectin [Salmo salar]
          Length = 134

 Score =  151 bits (383), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 48/133 (36%), Positives = 72/133 (54%), Gaps = 6/133 (4%)

Query: 2   CGLVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNLC---NPRFNAHGDVNTIVCN 58
            G+V  N++ K G+ L + G   ++A  F++N+G  ++++    NPRF+AHGD   +VCN
Sbjct: 2   SGVVVKNMSFKLGQTLTITGIPNSEATHFVINVGNSEDDIALHMNPRFDAHGDTRAVVCN 61

Query: 59  SKDAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYLS 115
           S   G W  E RE  FPF  G   ++   F +    + LPDG E  FPNR   E   Y+ 
Sbjct: 62  SYHGGKWCEEHREGGFPFNQGEEFKINITFTKEQFLVSLPDGSEIHFPNRQGDEKYKYMH 121

Query: 116 AGGDFKIKCVAFE 128
             GD +I+ V  +
Sbjct: 122 FEGDVRIQGVEIK 134


>gb|ACM08322.1| Beta-galactoside-binding lectin [Salmo salar]
 gb|ACM08899.1| Beta-galactoside-binding lectin [Salmo salar]
 gb|ACM09286.1| Beta-galactoside-binding lectin [Salmo salar]
 gb|ACM09664.1| Beta-galactoside-binding lectin [Salmo salar]
          Length = 134

 Score =  151 bits (382), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 50/133 (37%), Positives = 72/133 (54%), Gaps = 6/133 (4%)

Query: 2   CGLVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNLC---NPRFNAHGDVNTIVCN 58
            G+V  N++ K G+ L + G   ++A  F++N+G  +++L    NPRF+AHGD   +VCN
Sbjct: 2   SGVVVKNMSFKLGQTLTITGIPNSEATHFVINVGNSEDDLALHMNPRFDAHGDTRAVVCN 61

Query: 59  SKDAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYLS 115
           S   G W  E RE  FPF  G   ++   F +    + LPDG E  FPNR   E   Y+ 
Sbjct: 62  SYHGGKWCEEHREGGFPFNQGEEFKINITFTKEQFLVSLPDGSEIHFPNRQGDEKYKYMH 121

Query: 116 AGGDFKIKCVAFE 128
             GD +IK V  +
Sbjct: 122 FEGDVRIKGVEIK 134


>gb|ACO07656.1| Beta-galactoside-binding lectin [Oncorhynchus mykiss]
 gb|ACO07767.1| Beta-galactoside-binding lectin [Oncorhynchus mykiss]
          Length = 134

 Score =  150 bits (380), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 48/133 (36%), Positives = 71/133 (53%), Gaps = 6/133 (4%)

Query: 2   CGLVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNLC---NPRFNAHGDVNTIVCN 58
            G+V  N++ K G+ L + G   ++A  F++N+G  +++L    NPRF+AHGD   +VCN
Sbjct: 2   SGVVVKNMSFKVGQTLTITGIPNSEATHFVINVGNSEDDLALHMNPRFDAHGDTRAVVCN 61

Query: 59  SKDAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYLS 115
           S   G W  E RE  FPF  G   ++   F +    +  PDG E  FPNR   E   Y+ 
Sbjct: 62  SYHGGKWCEEHREGGFPFNQGEKFKINITFTKEQFLVSFPDGSEIHFPNRQGDEKYKYMH 121

Query: 116 AGGDFKIKCVAFE 128
             GD +I+ V  +
Sbjct: 122 FDGDVRIQGVEIK 134


>ref|NP_001076182.1| galectin-4 [Oryctolagus cuniculus]
 gb|AAD55242.1|AF091738_1 galectin-4 [Oryctolagus cuniculus]
          Length = 328

 Score =  150 bits (379), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 32/133 (24%), Positives = 61/133 (45%), Gaps = 14/133 (10%)

Query: 4   LVASNLNLKPGECLRVRGEVAADAKSFLLNL------GKDDNNLCNPRFNAHGDVNTIVC 57
            +   L+L  G  + ++G  +     F +N       G D     NPRF+     + +V 
Sbjct: 22  PIPGGLSL--GMSVYIQGVASEHMNRFFVNFVVGQDPGADIAFHFNPRFDGW---DKVVF 76

Query: 58  NSKDAGAWGAEQRESAFPFQPGSVVEVF---NQTDLTIKLPDGYEFKFPNRLNLEAINYL 114
           NS+  G WG+E+R+ + PF  G+  E+          + +     ++F +RL L+ + +L
Sbjct: 77  NSQQGGKWGSEERKRSMPFSKGAPFELVFTVLAEHYKVVVNGSPFYEFKHRLPLQMVTHL 136

Query: 115 SAGGDFKIKCVAF 127
              GD +++ + F
Sbjct: 137 HVDGDLRLQSINF 149



 Score =  105 bits (263), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 29/120 (24%), Positives = 50/120 (41%), Gaps = 5/120 (4%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNLGKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAEQR 70
           L     + V+G V    KSFL+N     +       N       +V NS+  G+WGAE+R
Sbjct: 207 LTARRTIIVKGYVPPTGKSFLINFKVGSSGDLALHINPRMTEGVVVRNSRLNGSWGAEER 266

Query: 71  ESA-FPFQPGSVVEVFNQTD---LTIKLPDGYEFKFPNRLN-LEAINYLSAGGDFKIKCV 125
           + A  PF PG   ++  +       +     + F + +R    + ++ +   GD  +  V
Sbjct: 267 KMAYNPFGPGQYFDLSIRCGMDRFKVYANGQHLFDYAHRFPAFQKVDVIEIQGDVALSYV 326


>gb|ACO07452.1| Beta-galactoside-binding lectin [Oncorhynchus mykiss]
 gb|ACO07992.1| Beta-galactoside-binding lectin [Oncorhynchus mykiss]
 gb|ACO08295.1| Beta-galactoside-binding lectin [Oncorhynchus mykiss]
          Length = 134

 Score =  150 bits (379), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 48/133 (36%), Positives = 71/133 (53%), Gaps = 6/133 (4%)

Query: 2   CGLVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNLC---NPRFNAHGDVNTIVCN 58
            G+V  N++ K G+ L + G   ++A  F++N+G  +++L    NPRF+AHGD   +VCN
Sbjct: 2   SGVVVKNMSFKVGQTLTITGIPNSEATHFVINVGNSEDDLALHMNPRFDAHGDTRAVVCN 61

Query: 59  SKDAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYLS 115
           S   G W  E RE  FPF  G   ++   F +    +  PDG E  FPNR   E   Y+ 
Sbjct: 62  SYHGGKWCEEHREGGFPFNQGEKFKINITFTKEQFLVSFPDGSEIHFPNRQGDEKYKYMH 121

Query: 116 AGGDFKIKCVAFE 128
             GD +I+ V  +
Sbjct: 122 FEGDVRIQGVEIK 134


>gb|ACM08580.1| Beta-galactoside-binding lectin [Salmo salar]
          Length = 134

 Score =  149 bits (378), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 48/133 (36%), Positives = 72/133 (54%), Gaps = 6/133 (4%)

Query: 2   CGLVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNLC---NPRFNAHGDVNTIVCN 58
            G+V  N++ K G+ L + G   ++A  F++N+G  ++++    NPRF+AHGD   +VCN
Sbjct: 2   SGVVVKNMSFKLGQTLTITGIPNSEATHFVINVGNSEDDIALHMNPRFDAHGDTRAVVCN 61

Query: 59  SKDAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYLS 115
           S   G W  E RE  FPF  G   ++   F +    + LPDG E  FPNR   E   Y+ 
Sbjct: 62  SHHGGKWCEEHREGGFPFNQGEEFKINITFTKEQFLVSLPDGSEIHFPNRQGDEKYKYMH 121

Query: 116 AGGDFKIKCVAFE 128
             GD +I+ V  +
Sbjct: 122 FEGDVRIQGVEIK 134


>gb|AAH71424.1| Lgals1l2 protein [Danio rerio]
          Length = 134

 Score =  149 bits (378), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 46/133 (34%), Positives = 72/133 (54%), Gaps = 6/133 (4%)

Query: 2   CGLVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNLC---NPRFNAHGDVNTIVCN 58
            G++  N++ K G+ L + G    D+ +F +N+G    ++    NPRF+AHGD  TIVCN
Sbjct: 2   AGVLIQNMSFKVGQTLTITGVPKPDSTNFAINIGHSPEDIALHMNPRFDAHGDQCTIVCN 61

Query: 59  SKDAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYLS 115
           S  +G+W  E R++ FPF      ++   F   +  + LPDG E  FPNR   E   Y+ 
Sbjct: 62  SFQSGSWCEEHRDNNFPFIQDKEFQIKITFTNEEFLVTLPDGSEIHFPNRQGSEKYKYMH 121

Query: 116 AGGDFKIKCVAFE 128
             G+ +I+ V  +
Sbjct: 122 FEGEVRIQGVEIK 134


>ref|NP_998059.1| proto galectin Gal1-L2 [Danio rerio]
 gb|AAR84190.1| proto galectin Gal1-L2 [Danio rerio]
          Length = 134

 Score =  149 bits (378), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 46/133 (34%), Positives = 71/133 (53%), Gaps = 6/133 (4%)

Query: 2   CGLVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNLC---NPRFNAHGDVNTIVCN 58
            G++  N++ K G+ L + G    D+ +F +N+G    ++    NPRF+AHGD  TIVCN
Sbjct: 2   AGVLIQNMSFKVGQTLTITGVPKPDSTNFAINIGHSPEDIALHMNPRFDAHGDQCTIVCN 61

Query: 59  SKDAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYLS 115
           S  +G+W  E R+  FPF      ++   F   +  + LPDG E  FPNR   E   Y+ 
Sbjct: 62  SFQSGSWCEEHRDDNFPFIQDKEFQIKITFTNEEFLVTLPDGSEIHFPNRQGSEKYKYMY 121

Query: 116 AGGDFKIKCVAFE 128
             G+ +I+ V  +
Sbjct: 122 FEGEVRIQGVEIK 134


>dbj|BAG59217.1| unnamed protein product [Homo sapiens]
          Length = 171

 Score =  149 bits (376), Expect = 9e-35,   Method: Composition-based stats.
 Identities = 30/126 (23%), Positives = 59/126 (46%), Gaps = 12/126 (9%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL------GKDDNNLCNPRFNAHGDVNTIVCNSKDAGA 64
           L  G  + ++G  +   K F +N       G D     NPRF+     + +V N+   G 
Sbjct: 27  LNVGMSVYIQGVASEHVKRFFVNFVVGQDPGSDVAFHFNPRFDGW---DKVVFNTLQGGK 83

Query: 65  WGAEQRESAFPFQPGSVVE---VFNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFK 121
           WG+E+R+ + PF+ G+  E   +       + +     +++ +RL L+ + +L   GD +
Sbjct: 84  WGSEERKRSMPFKKGAAFELVFIVLAEHYKVVVNGNPFYEYGHRLPLQMVTHLQVDGDLQ 143

Query: 122 IKCVAF 127
           ++ + F
Sbjct: 144 LQSINF 149


>emb|CAA34206.1| unnamed protein product [Mus sp.]
          Length = 264

 Score =  147 bits (373), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 38/132 (28%), Positives = 61/132 (46%), Gaps = 11/132 (8%)

Query: 5   VASNLNL----KPGECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVCN 58
           V  +L L     P   + + G V  +A   +L+   G D     NPRFN + +   IVCN
Sbjct: 130 VPYDLPLPGGVMPRMLITIMGTVKPNANRIVLDFRRGNDVAFHFNPRFNEN-NRRVIVCN 188

Query: 59  SKDAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRL-NLEAINYL 114
           +K    WG E+R+SAFPF+ G   ++          + + D +  ++ +R+ NL  I+ L
Sbjct: 189 TKQDNNWGKEERQSAFPFESGKPFKIQVLVEADHFKVAVNDAHLLQYNHRMKNLREISQL 248

Query: 115 SAGGDFKIKCVA 126
              GD  +    
Sbjct: 249 GISGDITLTSAN 260


>sp|P16110|LEG3_MOUSE RecName: Full=Galectin-3; AltName: Full=Galactose-specific lectin
           3; AltName: Full=Mac-2 antigen; AltName:
           Full=IgE-binding protein; AltName: Full=35 kDa lectin;
           AltName: Full=Carbohydrate-binding protein 35; Short=CBP
           35; AltName: Full=Laminin-binding protein; AltName:
           Full=Lectin L-29; AltName: Full=L-34 galactoside-binding
           lectin
 emb|CAA34736.1| unnamed protein product [Mus musculus]
          Length = 264

 Score =  147 bits (373), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 38/132 (28%), Positives = 61/132 (46%), Gaps = 11/132 (8%)

Query: 5   VASNLNL----KPGECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVCN 58
           V  +L L     P   + + G V  +A   +L+   G D     NPRFN + +   IVCN
Sbjct: 130 VPYDLPLPGGVMPRMLITIMGTVKPNANRIVLDFRRGNDVAFHFNPRFNEN-NRRVIVCN 188

Query: 59  SKDAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRL-NLEAINYL 114
           +K    WG E+R+SAFPF+ G   ++          + + D +  ++ +R+ NL  I+ L
Sbjct: 189 TKQDNNWGKEERQSAFPFESGKPFKIQVLVEADHFKVAVNDAHLLQYNHRMKNLREISQL 248

Query: 115 SAGGDFKIKCVA 126
              GD  +    
Sbjct: 249 GISGDITLTSAN 260


>ref|NP_034835.1| galectin 3 [Mus musculus]
 ref|NP_001139425.1| galectin 3 [Mus musculus]
 dbj|BAC40813.1| unnamed protein product [Mus musculus]
 dbj|BAE35163.1| unnamed protein product [Mus musculus]
 dbj|BAE33287.1| unnamed protein product [Mus musculus]
 dbj|BAE29081.1| unnamed protein product [Mus musculus]
 dbj|BAE42038.1| unnamed protein product [Mus musculus]
 gb|AAI32329.1| Lectin, galactose binding, soluble 3 [Mus musculus]
 gb|EDL20742.1| lectin, galactose binding, soluble 3, isoform CRA_a [Mus musculus]
 gb|EDL20745.1| lectin, galactose binding, soluble 3, isoform CRA_d [Mus musculus]
 gb|AAI38791.1| Lectin, galactose binding, soluble 3 [Mus musculus]
 gb|AAI45420.1| Lectin, galactose binding, soluble 3 [Mus musculus]
          Length = 264

 Score =  147 bits (373), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 38/132 (28%), Positives = 61/132 (46%), Gaps = 11/132 (8%)

Query: 5   VASNLNL----KPGECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVCN 58
           V  +L L     P   + + G V  +A   +L+   G D     NPRFN + +   IVCN
Sbjct: 130 VPYDLPLPGGVMPRMLITIMGTVKPNANRIVLDFRRGNDVAFHFNPRFNEN-NRRVIVCN 188

Query: 59  SKDAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRL-NLEAINYL 114
           +K    WG E+R+SAFPF+ G   ++          + + D +  ++ +R+ NL  I+ L
Sbjct: 189 TKQDNNWGKEERQSAFPFESGKPFKIQVLVEADHFKVAVNDAHLLQYNHRMKNLREISQL 248

Query: 115 SAGGDFKIKCVA 126
              GD  +    
Sbjct: 249 GISGDITLTSAN 260


>gb|EDL20744.1| lectin, galactose binding, soluble 3, isoform CRA_c [Mus musculus]
          Length = 273

 Score =  147 bits (373), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 38/132 (28%), Positives = 61/132 (46%), Gaps = 11/132 (8%)

Query: 5   VASNLNL----KPGECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVCN 58
           V  +L L     P   + + G V  +A   +L+   G D     NPRFN + +   IVCN
Sbjct: 139 VPYDLPLPGGVMPRMLITIMGTVKPNANRIVLDFRRGNDVAFHFNPRFNEN-NRRVIVCN 197

Query: 59  SKDAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRL-NLEAINYL 114
           +K    WG E+R+SAFPF+ G   ++          + + D +  ++ +R+ NL  I+ L
Sbjct: 198 TKQDNNWGKEERQSAFPFESGKPFKIQVLVEADHFKVAVNDAHLLQYNHRMKNLREISQL 257

Query: 115 SAGGDFKIKCVA 126
              GD  +    
Sbjct: 258 GISGDITLTSAN 269


>ref|NP_001136314.1| lectin, galactoside-binding, soluble, 3 [Sus scrofa]
 gb|ACJ64061.1| lectin galactoside-binding soluble 2 protein [Sus scrofa]
          Length = 131

 Score =  147 bits (373), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 49/128 (38%), Positives = 76/128 (59%), Gaps = 4/128 (3%)

Query: 4   LVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNLCNPRFNAHGDVNTIVCNSKDAG 63
           +   N+++K G+ L+++G++  DA  F++NLG+  + L    FN     +TIVCNS+D  
Sbjct: 5   VEIMNMDMKVGKTLKIKGKIDDDADGFVINLGQGTDKLA-LHFNPRFGESTIVCNSRDGN 63

Query: 64  AWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDF 120
           +WG EQR+S   F PGS V++   F +    +KLPDG++  FPNRL    ++YLS  G F
Sbjct: 64  SWGKEQRDSHMCFSPGSEVKLIVTFEEDGFKVKLPDGHQLTFPNRLGYSHLSYLSVQGGF 123

Query: 121 KIKCVAFE 128
            I     +
Sbjct: 124 NITSFKLD 131


>dbj|BAC56513.1| similar to galactose-binding lectin [Bos taurus]
          Length = 104

 Score =  147 bits (373), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 95/103 (92%), Positives = 95/103 (92%), Gaps = 6/103 (5%)

Query: 1   ACGLVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNN---LCNPRFNAHGDVNTIVC 57
           ACGLVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNN     NPRFNAHGDVNTIVC
Sbjct: 2   ACGLVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNLCLHFNPRFNAHGDVNTIVC 61

Query: 58  NSKDAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDG 97
           NSKDAGAWGAEQRESAFPFQPGSVVEV   FNQTDLTIKLPDG
Sbjct: 62  NSKDAGAWGAEQRESAFPFQPGSVVEVCISFNQTDLTIKLPDG 104


>ref|NP_037107.1| lectin, galactoside-binding, soluble, 4 [Rattus norvegicus]
 sp|P38552|LEG4_RAT RecName: Full=Galectin-4; AltName: Full=Lactose-binding lectin 4;
           AltName: Full=L-36 lactose-binding protein; Short=L36LBP
 gb|AAA41505.1| lactose-binding lectin
 gb|EDM07869.1| lectin, galactose binding, soluble 4 [Rattus norvegicus]
          Length = 324

 Score =  147 bits (372), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 29/126 (23%), Positives = 58/126 (46%), Gaps = 12/126 (9%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL------GKDDNNLCNPRFNAHGDVNTIVCNSKDAGA 64
           L  G  + ++G    + + F +N       G D     NPRF+     + +V N+  +G 
Sbjct: 27  LSVGMSIYIQGIAKDNMRRFHVNFAVGQDEGADIAFHFNPRFDGW---DKVVFNTMQSGQ 83

Query: 65  WGAEQRESAFPFQPGSVVEVFN---QTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFK 121
           WG E+++ + PFQ G   E+          + +     +++ +RL L+ + +L   GD +
Sbjct: 84  WGKEEKKKSMPFQKGHHFELVFMVMSEHYKVVVNGTPFYEYGHRLPLQMVTHLQVDGDLE 143

Query: 122 IKCVAF 127
           ++ + F
Sbjct: 144 LQSINF 149



 Score = 93.9 bits (233), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 28/124 (22%), Positives = 50/124 (40%), Gaps = 14/124 (11%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL----GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWG 66
           L     + ++G V   AK+ ++N       D     NPR       + +V NS   G+WG
Sbjct: 204 LTARRTIIIKGYVLPTAKNLIINFKVGSTGDIAFHMNPRI-----GDCVVRNSYMNGSWG 258

Query: 67  AEQRE-SAFPFQPGSVVEVFNQTD---LTIKLPDGYEFKFPNRL-NLEAINYLSAGGDFK 121
           +E+R+    PF  G   ++  +       +     + F F +R    + ++ L   GD  
Sbjct: 259 SEERKIPYNPFGAGQFFDLSIRCGTDRFKVFANGQHLFDFSHRFQAFQRVDMLEIKGDIT 318

Query: 122 IKCV 125
           +  V
Sbjct: 319 LSYV 322


>ref|NP_001029940.1| galectin-4 [Bos taurus]
 sp|Q3T0D6|LEG4_BOVIN RecName: Full=Galectin-4
 gb|AAI02445.1| Lectin, galactoside-binding, soluble, 4 [Bos taurus]
          Length = 332

 Score =  147 bits (372), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 32/126 (25%), Positives = 59/126 (46%), Gaps = 12/126 (9%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL------GKDDNNLCNPRFNAHGDVNTIVCNSKDAGA 64
           L+ G  + ++G  +   K F +N       G D     NPRF+     + +V NSK  G+
Sbjct: 27  LRVGMSVYIQGVASEHMKRFFVNFEVGQGQGADVAFHFNPRFDGW---DKVVLNSKQNGS 83

Query: 65  WGAEQRESAFPFQPGSVVEVFNQ---TDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFK 121
           WG E+R+ + PF+ G+  E+          + +      +F +R+ L+ + +L   GD  
Sbjct: 84  WGQEERKMSMPFRKGAAFELVFMVMTEHFKVVVNGTPFHEFKHRIPLQMVTHLHVDGDLM 143

Query: 122 IKCVAF 127
           ++ + F
Sbjct: 144 LQSINF 149



 Score =  105 bits (264), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 28/120 (23%), Positives = 52/120 (43%), Gaps = 5/120 (4%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNLGKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAEQR 70
           L     + ++G +   AKSF++N     +       N       +V NS   G+WG+E+R
Sbjct: 211 LIVRRTIIIKGYIPPTAKSFVINFKVGSSGDVALHINPRMTEGAVVRNSFLNGSWGSEER 270

Query: 71  E-SAFPFQPGSVVEVFNQTD---LTIKLPDGYEFKFPNRLN-LEAINYLSAGGDFKIKCV 125
           + S  PF PG   ++  +       +     + F F +RL+  + ++ +   GD  +  V
Sbjct: 271 KVSYNPFGPGQFFDLSVRCGADRFKVYANGKHLFDFSHRLSAFQRVDLVEIHGDVTLSYV 330


>sp|P47953|LEG3_CRILO RecName: Full=Galectin-3; AltName: Full=Galactose-specific lectin
           3; AltName: Full=Mac-2 antigen; AltName:
           Full=IgE-binding protein; AltName: Full=35 kDa lectin;
           AltName: Full=Carbohydrate-binding protein 35; Short=CBP
           35; AltName: Full=Laminin-binding protein; AltName:
           Full=Lectin L-29; AltName: Full=CBP30
 pir||A54909 carbohydrate-binding protein CBP30 - hamster
 emb|CAA55479.1| galectin 3 [Cricetulus longicaudatus]
          Length = 245

 Score =  147 bits (372), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 37/122 (30%), Positives = 59/122 (48%), Gaps = 7/122 (5%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAE 68
           + P   + + G V  +A   +LN   G D     NPRFN + +   IVCN+K    WG E
Sbjct: 121 VMPRMLITIMGTVKPNANRIILNFLRGNDIAFHFNPRFNEN-NRRVIVCNTKQDNNWGRE 179

Query: 69  QRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRL-NLEAINYLSAGGDFKIKC 124
           +R+SAFPF+ G   ++          + + D +  ++ +R+ NL  IN +   GD  +  
Sbjct: 180 ERQSAFPFESGRPFKIQVLVEADHFKVAVNDAHLLQYNHRMKNLREINQMEISGDITLTS 239

Query: 125 VA 126
            A
Sbjct: 240 AA 241


>gb|AAP36224.1| Homo sapiens lectin, galactoside-binding, soluble, 4 (galectin 4)
           [synthetic construct]
 gb|AAX43701.1| lectin galactoside-binding soluble 4 [synthetic construct]
 gb|AAX43702.1| lectin galactoside-binding soluble 4 [synthetic construct]
          Length = 324

 Score =  147 bits (372), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 30/126 (23%), Positives = 59/126 (46%), Gaps = 12/126 (9%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL------GKDDNNLCNPRFNAHGDVNTIVCNSKDAGA 64
           L  G  + ++G  +   K F +N       G D     NPRF+     + +V N+   G 
Sbjct: 27  LNVGMSVYIQGVASEHMKRFFVNFVVGQDPGSDVAFHFNPRFDGW---DKVVFNTLQGGK 83

Query: 65  WGAEQRESAFPFQPGSVVE---VFNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFK 121
           WG+E+R+ + PF+ G+  E   +       + +     +++ +RL L+ + +L   GD +
Sbjct: 84  WGSEERKRSMPFKKGAAFELVFIVLAEHYKVVVNGNPFYEYGHRLPLQMVTHLQVDGDLQ 143

Query: 122 IKCVAF 127
           ++ + F
Sbjct: 144 LQSINF 149



 Score =  110 bits (275), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 28/120 (23%), Positives = 51/120 (42%), Gaps = 5/120 (4%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNLGKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAEQR 70
           L     + ++G V    KSF +N     +       N      T+V NS   G+WG+E++
Sbjct: 202 LTARRTIIIKGYVPPTGKSFAINFKVGSSGDIALHINPRMGNGTVVRNSLLNGSWGSEEK 261

Query: 71  E-SAFPFQPGSVVEVFNQTD---LTIKLPDGYEFKFPNRLN-LEAINYLSAGGDFKIKCV 125
           + +  PF PG   ++  +       +     + F F +RL+  + ++ L   GD  +  V
Sbjct: 262 KITHNPFGPGQFFDLSIRCGLDRFKVYANGQHLFDFAHRLSAFQRVDTLEIQGDVTLSYV 321


>ref|NP_006140.1| galectin-4 [Homo sapiens]
 sp|P56470|LEG4_HUMAN RecName: Full=Galectin-4; AltName: Full=Lactose-binding lectin 4;
           AltName: Full=L-36 lactose-binding protein;
           Short=L36LBP; AltName: Full=Antigen NY-CO-27
 gb|AAC51763.1| galectin-4 [Homo sapiens]
 dbj|BAA22165.1| galectin-4 [Homo sapiens]
 gb|AAB86590.1| galectin-4 [Homo sapiens]
 gb|AAH03661.1| Lectin, galactoside-binding, soluble, 4 [Homo sapiens]
 gb|AAH05146.1| Lectin, galactoside-binding, soluble, 4 [Homo sapiens]
 gb|AAH34750.1| Lectin, galactoside-binding, soluble, 4 [Homo sapiens]
 gb|AAP35679.1| lectin, galactoside-binding, soluble, 4 (galectin 4) [Homo sapiens]
 emb|CAG38781.1| LGALS4 [Homo sapiens]
 gb|AAX32077.1| lectin galactoside-binding soluble 4 [synthetic construct]
 gb|AAX32078.1| lectin galactoside-binding soluble 4 [synthetic construct]
 gb|EAW56819.1| lectin, galactoside-binding, soluble, 4 (galectin 4), isoform CRA_a
           [Homo sapiens]
 dbj|BAF82958.1| unnamed protein product [Homo sapiens]
          Length = 323

 Score =  147 bits (372), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 30/126 (23%), Positives = 59/126 (46%), Gaps = 12/126 (9%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL------GKDDNNLCNPRFNAHGDVNTIVCNSKDAGA 64
           L  G  + ++G  +   K F +N       G D     NPRF+     + +V N+   G 
Sbjct: 27  LNVGMSVYIQGVASEHMKRFFVNFVVGQDPGSDVAFHFNPRFDGW---DKVVFNTLQGGK 83

Query: 65  WGAEQRESAFPFQPGSVVE---VFNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFK 121
           WG+E+R+ + PF+ G+  E   +       + +     +++ +RL L+ + +L   GD +
Sbjct: 84  WGSEERKRSMPFKKGAAFELVFIVLAEHYKVVVNGNPFYEYGHRLPLQMVTHLQVDGDLQ 143

Query: 122 IKCVAF 127
           ++ + F
Sbjct: 144 LQSINF 149



 Score =  110 bits (275), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 28/120 (23%), Positives = 51/120 (42%), Gaps = 5/120 (4%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNLGKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAEQR 70
           L     + ++G V    KSF +N     +       N      T+V NS   G+WG+E++
Sbjct: 202 LTARRTIIIKGYVPPTGKSFAINFKVGSSGDIALHINPRMGNGTVVRNSLLNGSWGSEEK 261

Query: 71  E-SAFPFQPGSVVEVFNQTD---LTIKLPDGYEFKFPNRLN-LEAINYLSAGGDFKIKCV 125
           + +  PF PG   ++  +       +     + F F +RL+  + ++ L   GD  +  V
Sbjct: 262 KITHNPFGPGQFFDLSIRCGLDRFKVYANGQHLFDFAHRLSAFQRVDTLEIQGDVTLSYV 321


>gb|ACO08799.1| Beta-galactoside-binding lectin [Oncorhynchus mykiss]
          Length = 134

 Score =  147 bits (372), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 47/133 (35%), Positives = 71/133 (53%), Gaps = 6/133 (4%)

Query: 2   CGLVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNLC---NPRFNAHGDVNTIVCN 58
            G+V  N++ K G+ L + G   ++A  F++N+G  +++L    NPRF+AHGD   +VC+
Sbjct: 2   SGVVVKNMSSKVGQTLTITGIPNSEATHFVINVGNSEDDLALHMNPRFDAHGDTRAVVCD 61

Query: 59  SKDAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYLS 115
           S   G W  E RE  FPF  G   ++   F +    +  PDG E  FPNR   E   Y+ 
Sbjct: 62  SYHGGKWCEEHREGGFPFNQGEKFKINITFTKEQFLVSFPDGSEIHFPNRQGDEKYKYMH 121

Query: 116 AGGDFKIKCVAFE 128
             GD +I+ V  +
Sbjct: 122 FDGDVRIQGVEIK 134


>ref|XP_855387.1| PREDICTED: similar to Galectin-4 (Lactose-binding lectin 4) (L-36
           lactose binding protein) (L36LBP) (Antigen NY-CO-27)
           [Canis familiaris]
          Length = 798

 Score =  147 bits (371), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 30/126 (23%), Positives = 59/126 (46%), Gaps = 12/126 (9%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL------GKDDNNLCNPRFNAHGDVNTIVCNSKDAGA 64
           L  G  + ++G  +   + F +N       G D     NPRF+     + +V NS   G 
Sbjct: 74  LSVGMSVYIQGITSEHMRRFCVNFVAGAHPGSDIAFHFNPRFDGW---DKVVFNSHLGGK 130

Query: 65  WGAEQRESAFPFQPGSVVEVFNQ---TDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFK 121
           WG+E+++ + PF+ G+  E+          + +     ++F +RL L+ + +L   GD +
Sbjct: 131 WGSEEKKRSMPFRKGTHFELVFMVLAEHYKVVVNGNPFYEFGHRLPLQLVTHLQVEGDVE 190

Query: 122 IKCVAF 127
           ++ + F
Sbjct: 191 LQSINF 196



 Score =  124 bits (313), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 34/142 (23%), Positives = 56/142 (39%), Gaps = 26/142 (18%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAE 68
           ++ G  +R+RG V   A  F +NL  G+   +     FN   D +T+V N+ + GAWG E
Sbjct: 655 IRVGTVMRIRGVVPNKAGRFYVNLLCGEAPGSEAALHFNPRLDESTVVFNTLEQGAWGRE 714

Query: 69  QRESAFPFQPGSVVE---VFNQTDLTIK---------------------LPDGYEFKFPN 104
           +R +  PFQ G   +   +                              + D     F  
Sbjct: 715 ERGTGIPFQRGQPFDVLLIATDEGFKRIRTGVRGQGRGRARSRERGPAVVGDSEYHHFRY 774

Query: 105 RLNLEAINYLSAGGDFKIKCVA 126
           R+    +  L  GGD +++ V+
Sbjct: 775 RIPPARVRLLEVGGDLQLESVS 796



 Score =  105 bits (262), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 29/120 (24%), Positives = 52/120 (43%), Gaps = 5/120 (4%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNLGKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAEQR 70
           L     + ++G V   +KSF++N   + +       N       +V NS   G+WG+E R
Sbjct: 249 LTVRRTVIIKGFVPFTSKSFVINFMVESSGDLALHINPRLTEGLVVRNSCLNGSWGSEDR 308

Query: 71  E-SAFPFQPGSVVEVFNQTD---LTIKLPDGYEFKFPNR-LNLEAINYLSAGGDFKIKCV 125
           + S  PF PG   ++  +       +     + F F +R L L+ ++ L   GD  +  +
Sbjct: 309 KLSYNPFIPGQFFDLSIRCGMDRFKVYANGQHLFDFSHRLLALQNVDMLEINGDVTLSYI 368


>ref|NP_034836.1| lectin, galactose binding, soluble 4 [Mus musculus]
 sp|Q8K419|LEG4_MOUSE RecName: Full=Galectin-4; AltName: Full=Lactose-binding lectin 4
 gb|AAH11236.1| Lectin, galactose binding, soluble 4 [Mus musculus]
 gb|AAH21632.1| Lectin, galactose binding, soluble 4 [Mus musculus]
 gb|AAH30297.1| Lectin, galactose binding, soluble 4 [Mus musculus]
 gb|AAK97790.1| galectin-4 [Mus musculus]
 dbj|BAE26616.1| unnamed protein product [Mus musculus]
 gb|ABM74070.1| galectin-4 [Mus musculus castaneus]
 gb|ABM74071.1| galectin-4 [Mus musculus domesticus]
 gb|ABM74072.1| galectin-4 [Mus spretus]
 gb|ABM74073.1| galectin-4 [Mus spretus]
 gb|EDL24106.1| mCG2985 [Mus musculus]
 gb|AAI41107.1| Lectin, galactose binding, soluble 4 [Mus musculus]
 gb|AAI45388.1| Lectin, galactose binding, soluble 4 [Mus musculus]
          Length = 326

 Score =  147 bits (371), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 28/126 (22%), Positives = 58/126 (46%), Gaps = 12/126 (9%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL------GKDDNNLCNPRFNAHGDVNTIVCNSKDAGA 64
           L  G  + ++G    + + F +N       G D     NPRF+     + +V N+  +G 
Sbjct: 27  LSVGMSVYIQGMAKENMRRFHVNFAVGQDDGADVAFHFNPRFDGW---DKVVFNTMQSGQ 83

Query: 65  WGAEQRESAFPFQPGSVVEVFNQ---TDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFK 121
           WG E+++ + PFQ G   E+          + +     +++ +RL ++ + +L   GD +
Sbjct: 84  WGKEEKKKSMPFQKGKHFELVFMVMPEHYKVVVNGNSFYEYGHRLPVQMVTHLQVDGDLE 143

Query: 122 IKCVAF 127
           ++ + F
Sbjct: 144 LQSINF 149



 Score = 98.9 bits (246), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 30/124 (24%), Positives = 54/124 (43%), Gaps = 14/124 (11%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL----GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWG 66
           L     + ++G V   A++F++N       D     NPR       +++V NS   G+WG
Sbjct: 206 LTVRRTIIIKGYVLPTARNFVINFKVGSSGDIALHLNPRI-----GDSVVRNSFMNGSWG 260

Query: 67  AEQRE-SAFPFQPGSVVEVFNQTD---LTIKLPDGYEFKFPNRL-NLEAINYLSAGGDFK 121
           AE+R+ +  PF PG   ++  +       +     + F F +R    + ++ L   GD  
Sbjct: 261 AEERKVAYNPFGPGQFFDLSIRCGMDRFKVFANGQHLFDFSHRFQAFQMVDTLEINGDIT 320

Query: 122 IKCV 125
           +  V
Sbjct: 321 LSYV 324


>gb|AAH94008.1| Lectin, galactose binding, soluble 4 [Mus musculus]
          Length = 326

 Score =  147 bits (371), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 28/126 (22%), Positives = 58/126 (46%), Gaps = 12/126 (9%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL------GKDDNNLCNPRFNAHGDVNTIVCNSKDAGA 64
           L  G  + ++G    + + F +N       G D     NPRF+     + +V N+  +G 
Sbjct: 27  LSVGMSVYIQGMAKENMRRFHVNFAVGQDDGADVAFHFNPRFDGW---DKVVFNTMQSGQ 83

Query: 65  WGAEQRESAFPFQPGSVVEVFNQ---TDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFK 121
           WG E+++ + PFQ G   E+          + +     +++ +RL ++ + +L   GD +
Sbjct: 84  WGKEEKKKSMPFQKGKHFELVFMVMPEHYKVVVNGNSFYEYGHRLPVQMVTHLQVDGDLE 143

Query: 122 IKCVAF 127
           ++ + F
Sbjct: 144 LQSINF 149



 Score = 98.2 bits (244), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 30/124 (24%), Positives = 54/124 (43%), Gaps = 14/124 (11%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL----GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWG 66
           L     + ++G V   A++F++N       D     NPR       +++V NS   G+WG
Sbjct: 206 LTVRRTIIIKGYVLPTARNFVINFKVGSSGDIALHLNPRI-----GDSVVRNSFMNGSWG 260

Query: 67  AEQRE-SAFPFQPGSVVEVFNQTD---LTIKLPDGYEFKFPNRL-NLEAINYLSAGGDFK 121
           AE+R+ +  PF PG   ++  +       +     + F F +R    + ++ L   GD  
Sbjct: 261 AEERKVAYNPFGPGQFFDLSIRCGMDRFKVFANGQHLFDFSHRFQAFQMVDTLGINGDIT 320

Query: 122 IKCV 125
           +  V
Sbjct: 321 LSYV 324


>ref|XP_001084043.1| PREDICTED: galectin 4 [Macaca mulatta]
          Length = 324

 Score =  146 bits (370), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 29/126 (23%), Positives = 58/126 (46%), Gaps = 12/126 (9%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL------GKDDNNLCNPRFNAHGDVNTIVCNSKDAGA 64
           L  G  + ++G      + F +N       G D     NPRF+     + +V N+   G 
Sbjct: 27  LSVGMSVYIQGVANEHMRRFFVNFAVGQDPGADIAFHFNPRFDGW---DKVVFNTLQGGK 83

Query: 65  WGAEQRESAFPFQPGSVVEVF---NQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFK 121
           WG+E+R+ + PF+ G+  E+          + +     +++ +RL L+ + +L   GD +
Sbjct: 84  WGSEERKRSMPFKKGAAFELVFLVLAEHYKVVVNGNSFYEYGHRLPLQMVTHLQVDGDLQ 143

Query: 122 IKCVAF 127
           ++ + F
Sbjct: 144 LQSINF 149



 Score =  105 bits (264), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 28/120 (23%), Positives = 49/120 (40%), Gaps = 5/120 (4%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNLGKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAEQR 70
           L     + ++G V    KSF +N             N      T+V NS   G+WG+E+R
Sbjct: 203 LTARRTIIIKGYVPPTGKSFAINFKVGSTGDIALHINPRMGDGTVVRNSLLKGSWGSEER 262

Query: 71  E-SAFPFQPGSVVEVFNQTD---LTIKLPDGYEFKFPNR-LNLEAINYLSAGGDFKIKCV 125
           + +  PF PG   ++  +       +     + F F +R L  + ++ +   GD  +  V
Sbjct: 263 KITHNPFGPGQFFDLSIRCGLDRFKVFANGQHLFDFAHRFLAFQRVDTVEIQGDVTLSYV 322


>ref|XP_001362619.1| PREDICTED: similar to galectin-4 isoform 1 [Monodelphis domestica]
          Length = 322

 Score =  146 bits (369), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 29/126 (23%), Positives = 59/126 (46%), Gaps = 12/126 (9%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL------GKDDNNLCNPRFNAHGDVNTIVCNSKDAGA 64
           L+ G  + ++G      K F +N       G D     NPRF+     + +V NS  +G 
Sbjct: 27  LRLGMSVYIQGTTNDHLKRFHVNFSTGPDPGSDVAFHFNPRFDGW---DKVVFNSMQSGR 83

Query: 65  WGAEQRESAFPFQPGSVVEVFN---QTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFK 121
           WG+E+R+ + PF+ G+  E+          + +     +++ +R+ ++   +L   GD +
Sbjct: 84  WGSEERKKSMPFKRGAPFELVIMVMSEHYKVVVNGNPFYEYGHRMPIQMATHLQMDGDLQ 143

Query: 122 IKCVAF 127
           ++ + F
Sbjct: 144 LQSINF 149



 Score = 98.9 bits (246), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 29/120 (24%), Positives = 50/120 (41%), Gaps = 5/120 (4%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNLGKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAEQR 70
           L P + + ++G+V+  A S ++NL    +       N       +V NS   G WG+E+R
Sbjct: 201 LTPRKTIVIKGQVSQKANSVIINLKVASSGDLALHINPRLSEGAVVRNSFMGGKWGSEER 260

Query: 71  ESAF-PFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRL-NLEAINYLSAGGDFKIKCV 125
              F PF  G   ++     Q    +     + F F +RL     ++ +   GD  +  V
Sbjct: 261 NMTFNPFIRGHFFDLSIRCGQDRFKVFANGEHVFDFGHRLTAFHQVDTVEIQGDLTLSYV 320


>ref|XP_001495783.2| PREDICTED: similar to lectin, galactose binding, soluble 3 [Equus
           caballus]
          Length = 266

 Score =  145 bits (367), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 39/132 (29%), Positives = 61/132 (46%), Gaps = 11/132 (8%)

Query: 5   VASNLNL----KPGECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVCN 58
           V  +L L     P   + + G V  +   F LN   G D     NPRFN + +   IVCN
Sbjct: 132 VPYDLPLPGGVTPRMLITILGTVKPNPNRFALNFNRGHDVAFHFNPRFNEN-NRRVIVCN 190

Query: 59  SKDAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRL-NLEAINYL 114
           +K    WG E+R++ FPF+ G   ++          + + D +  ++ +R+ NL  IN L
Sbjct: 191 TKQDNVWGREERQAVFPFESGKPFKIQVLVEADHFKVAVNDAHLLQYNHRMRNLREINTL 250

Query: 115 SAGGDFKIKCVA 126
           S  GD  +   +
Sbjct: 251 SISGDINLTSAS 262


>ref|XP_001148520.1| PREDICTED: galectin 9 isoform 2 [Pan troglodytes]
 ref|XP_511349.2| PREDICTED: galectin 9 isoform 4 [Pan troglodytes]
          Length = 348

 Score =  145 bits (367), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 31/127 (24%), Positives = 60/127 (47%), Gaps = 12/127 (9%)

Query: 11  LKPGECLRVRGEVAADA-KSFLLNL-----GKDDNNLCNPRFNAHGDVNTIVCNSKDAGA 64
           L+ G  + V G V + +   F +N      G D     NPRF    D   +VCN++  G+
Sbjct: 25  LQDGLQITVNGTVLSSSGTRFAVNFQTGFSGNDIAFHFNPRFE---DGGYVVCNTRQNGS 81

Query: 65  WGAEQRESAFPFQPGSVVE---VFNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFK 121
           WG E+R++  PFQ G   +   +   +D  + +      ++ +R+    ++ +S  G  +
Sbjct: 82  WGPEERKTHMPFQKGMPFDLCFLVQSSDFKVMVNGSLFVQYFHRVPFHRVDTISINGSVQ 141

Query: 122 IKCVAFE 128
           +  ++F+
Sbjct: 142 LSYISFQ 148



 Score =  112 bits (282), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 37/122 (30%), Positives = 54/122 (44%), Gaps = 12/122 (9%)

Query: 12  KPGECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAEQ 69
            P     + G V   A+ F +NL  G       NPRF    D N +V N++   +WG+E+
Sbjct: 229 HPXXXXXLSGTVLPSAQRFHINLCSGSHIAFHLNPRF----DENAVVRNTQINNSWGSEE 284

Query: 70  RE--SAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRL-NLEAINYLSAGGDFKIK 123
           R      PF  G    V        L + +   + F++ +RL NL  IN L  GGD ++ 
Sbjct: 285 RSLPRKMPFVRGQSFLVWILCEAHCLKVAVDGQHVFEYYHRLRNLPTINKLEVGGDIQLT 344

Query: 124 CV 125
            V
Sbjct: 345 HV 346


>gb|AAH27504.1| Lgals2 protein [Mus musculus]
          Length = 130

 Score =  145 bits (366), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 53/126 (42%), Positives = 74/126 (58%), Gaps = 5/126 (3%)

Query: 6   ASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNLCNPRFNAHGDVNTIVCNSKDAGAW 65
             +LN+KPG  L+++G++  D   FL+NLG+    L N  FN   D +TIVCN+ + G W
Sbjct: 7   VKDLNMKPGMSLKIKGKIHNDVDRFLINLGQGKETL-NLHFNPRFDESTIVCNTSEGGRW 65

Query: 66  GAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFKI 122
           G EQRE+   F PGS V++   F   D  + LPDG++  FPNRL    ++YLS GG  +I
Sbjct: 66  GQEQRENHMCFSPGSEVKITITFQDKDFKVTLPDGHQLTFPNRLGHSQLHYLSMGG-LQI 124

Query: 123 KCVAFE 128
                E
Sbjct: 125 SSFKLE 130


>ref|XP_001148579.1| PREDICTED: galectin 9 isoform 3 [Pan troglodytes]
          Length = 316

 Score =  145 bits (366), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 31/127 (24%), Positives = 60/127 (47%), Gaps = 12/127 (9%)

Query: 11  LKPGECLRVRGEVAADA-KSFLLNL-----GKDDNNLCNPRFNAHGDVNTIVCNSKDAGA 64
           L+ G  + V G V + +   F +N      G D     NPRF    D   +VCN++  G+
Sbjct: 25  LQDGLQITVNGTVLSSSGTRFAVNFQTGFSGNDIAFHFNPRFE---DGGYVVCNTRQNGS 81

Query: 65  WGAEQRESAFPFQPGSVVE---VFNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFK 121
           WG E+R++  PFQ G   +   +   +D  + +      ++ +R+    ++ +S  G  +
Sbjct: 82  WGPEERKTHMPFQKGMPFDLCFLVQSSDFKVMVNGSLFVQYFHRVPFHRVDTISINGSVQ 141

Query: 122 IKCVAFE 128
           +  ++F+
Sbjct: 142 LSYISFQ 148



 Score =  112 bits (282), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 37/122 (30%), Positives = 54/122 (44%), Gaps = 12/122 (9%)

Query: 12  KPGECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAEQ 69
            P     + G V   A+ F +NL  G       NPRF    D N +V N++   +WG+E+
Sbjct: 197 HPXXXXXLSGTVLPSAQRFHINLCSGSHIAFHLNPRF----DENAVVRNTQINNSWGSEE 252

Query: 70  RE--SAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRL-NLEAINYLSAGGDFKIK 123
           R      PF  G    V        L + +   + F++ +RL NL  IN L  GGD ++ 
Sbjct: 253 RSLPRKMPFVRGQSFLVWILCEAHCLKVAVDGQHVFEYYHRLRNLPTINKLEVGGDIQLT 312

Query: 124 CV 125
            V
Sbjct: 313 HV 314


>ref|XP_001471707.1| PREDICTED: hypothetical protein [Mus musculus]
          Length = 302

 Score =  145 bits (366), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 28/126 (22%), Positives = 58/126 (46%), Gaps = 12/126 (9%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL------GKDDNNLCNPRFNAHGDVNTIVCNSKDAGA 64
           L  G  + ++G    + + F +N       G D     NPRF+     + +V N+  +G 
Sbjct: 27  LSVGMSVYIQGMAKENMRRFHVNFAVGQDDGADVAFHFNPRFDGW---DKVVFNTMQSGQ 83

Query: 65  WGAEQRESAFPFQPGSVVEVFNQ---TDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFK 121
           WG E+++ + PFQ G   E+          + +     +++ +RL ++ + +L   GD +
Sbjct: 84  WGKEEKKKSMPFQKGKHFELVFMVMPEHYKVVVNGNSFYEYGHRLPVQMVTHLQVDGDLE 143

Query: 122 IKCVAF 127
           ++ + F
Sbjct: 144 LQSINF 149



 Score = 97.8 bits (243), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 30/124 (24%), Positives = 54/124 (43%), Gaps = 14/124 (11%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL----GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWG 66
           L     + ++G V   A++F++N       D     NPR       +++V NS   G+WG
Sbjct: 182 LTVRRTIIIKGYVLPTARNFVINFKVGSSGDIALHLNPRI-----GDSVVRNSFMNGSWG 236

Query: 67  AEQRE-SAFPFQPGSVVEVFNQTD---LTIKLPDGYEFKFPNRL-NLEAINYLSAGGDFK 121
           AE+R+ +  PF PG   ++  +       +     + F F +R    + ++ L   GD  
Sbjct: 237 AEERKVAYNPFGPGQFFDLSIRCGMDRFKVFANGQHLFDFSHRFQAFQMVDTLEINGDIT 296

Query: 122 IKCV 125
           +  V
Sbjct: 297 LSYV 300


>gb|ACO08703.1| Beta-galactoside-binding lectin [Oncorhynchus mykiss]
          Length = 134

 Score =  145 bits (366), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 48/133 (36%), Positives = 70/133 (52%), Gaps = 6/133 (4%)

Query: 2   CGLVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNLC---NPRFNAHGDVNTIVCN 58
            G+V  N++ K G+ L + G   ++A  F+ N+G  +++L    NPRF+AHGD   +VCN
Sbjct: 2   SGVVVKNVSFKVGQTLTITGIPNSEATHFVTNVGNSEDDLALHMNPRFDAHGDTRAVVCN 61

Query: 59  SKDAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYLS 115
           S   G W  E RE  FPF  G   ++   F +    +  PDG E  FPNR   E   Y+ 
Sbjct: 62  SYHGGKWCEEHREGGFPFNQGEKFKINITFTKEQFLVSFPDGSEIHFPNRQGDEKYKYMH 121

Query: 116 AGGDFKIKCVAFE 128
             GD +I+ V  +
Sbjct: 122 FEGDVRIQGVEIK 134


>ref|XP_001362707.1| PREDICTED: similar to galectin-4 isoform 2 [Monodelphis domestica]
          Length = 303

 Score =  144 bits (365), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 29/126 (23%), Positives = 59/126 (46%), Gaps = 12/126 (9%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL------GKDDNNLCNPRFNAHGDVNTIVCNSKDAGA 64
           L+ G  + ++G      K F +N       G D     NPRF+     + +V NS  +G 
Sbjct: 27  LRLGMSVYIQGTTNDHLKRFHVNFSTGPDPGSDVAFHFNPRFDGW---DKVVFNSMQSGR 83

Query: 65  WGAEQRESAFPFQPGSVVEVFN---QTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFK 121
           WG+E+R+ + PF+ G+  E+          + +     +++ +R+ ++   +L   GD +
Sbjct: 84  WGSEERKKSMPFKRGAPFELVIMVMSEHYKVVVNGNPFYEYGHRMPIQMATHLQMDGDLQ 143

Query: 122 IKCVAF 127
           ++ + F
Sbjct: 144 LQSINF 149



 Score = 98.2 bits (244), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 29/120 (24%), Positives = 50/120 (41%), Gaps = 5/120 (4%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNLGKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAEQR 70
           L P + + ++G+V+  A S ++NL    +       N       +V NS   G WG+E+R
Sbjct: 182 LTPRKTIVIKGQVSQKANSVIINLKVASSGDLALHINPRLSEGAVVRNSFMGGKWGSEER 241

Query: 71  ESAF-PFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRL-NLEAINYLSAGGDFKIKCV 125
              F PF  G   ++     Q    +     + F F +RL     ++ +   GD  +  V
Sbjct: 242 NMTFNPFIRGHFFDLSIRCGQDRFKVFANGEHVFDFGHRLTAFHQVDTVEIQGDLTLSYV 301


>ref|NP_033665.1| galectin-9 isoform long [Homo sapiens]
 sp|O00182|LEG9_HUMAN RecName: Full=Galectin-9; AltName: Full=HOM-HD-21; AltName:
           Full=Ecalectin
 dbj|BAA22166.1| galectin-9 isoform [Homo sapiens]
 dbj|BAB83625.1| galectin-9 [Homo sapiens]
 gb|EAW51044.1| lectin, galactoside-binding, soluble, 9 (galectin 9), isoform CRA_f
           [Homo sapiens]
 gb|EAW51045.1| lectin, galactoside-binding, soluble, 9 (galectin 9), isoform CRA_f
           [Homo sapiens]
 dbj|BAF76328.1| urate transporter isoform [Homo sapiens]
          Length = 355

 Score =  144 bits (365), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 31/127 (24%), Positives = 60/127 (47%), Gaps = 12/127 (9%)

Query: 11  LKPGECLRVRGEVAADA-KSFLLNL-----GKDDNNLCNPRFNAHGDVNTIVCNSKDAGA 64
           L+ G  + V G V + +   F +N      G D     NPRF    D   +VCN++  G+
Sbjct: 25  LQDGLQITVNGTVLSSSGTRFAVNFQTGFSGNDIAFHFNPRFE---DGGYVVCNTRQNGS 81

Query: 65  WGAEQRESAFPFQPGSVVE---VFNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFK 121
           WG E+R++  PFQ G   +   +   +D  + +      ++ +R+    ++ +S  G  +
Sbjct: 82  WGPEERKTHMPFQKGMPFDLCFLVQSSDFKVMVNGILFVQYFHRVPFHRVDTISVNGSVQ 141

Query: 122 IKCVAFE 128
           +  ++F+
Sbjct: 142 LSYISFQ 148



 Score =  120 bits (302), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 37/123 (30%), Positives = 57/123 (46%), Gaps = 12/123 (9%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAE 68
           L P + + + G V   A+ F +NL  G       NPRF    D N +V N++   +WG+E
Sbjct: 235 LYPSKSILLSGTVLPSAQRFHINLCSGNHIAFHLNPRF----DENAVVRNTQIDNSWGSE 290

Query: 69  QRE--SAFPFQPGSVV---EVFNQTDLTIKLPDGYEFKFPNRL-NLEAINYLSAGGDFKI 122
           +R      PF  G       +     L + +   + F++ +RL NL  IN L  GGD ++
Sbjct: 291 ERSLPRKMPFVRGQSFSVWILCEAHCLKVAVDGQHLFEYYHRLRNLPTINRLEVGGDIQL 350

Query: 123 KCV 125
             V
Sbjct: 351 THV 353


>dbj|BAA31542.1| ecalectin [Homo sapiens]
 dbj|BAG54277.1| unnamed protein product [Homo sapiens]
          Length = 323

 Score =  144 bits (365), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 31/127 (24%), Positives = 60/127 (47%), Gaps = 12/127 (9%)

Query: 11  LKPGECLRVRGEVAADA-KSFLLNL-----GKDDNNLCNPRFNAHGDVNTIVCNSKDAGA 64
           L+ G  + V G V + +   F +N      G D     NPRF    D   +VCN++  G+
Sbjct: 25  LQDGLQITVNGTVLSSSGTRFAVNFQTGFSGNDIAFHFNPRFE---DGGYVVCNTRQNGS 81

Query: 65  WGAEQRESAFPFQPGSVVE---VFNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFK 121
           WG E+R++  PFQ G   +   +   +D  + +      ++ +R+    ++ +S  G  +
Sbjct: 82  WGPEERKTHMPFQKGMPFDLCFLVQSSDFKVMVNGILFVQYFHRVPFHRVDTISVNGSVQ 141

Query: 122 IKCVAFE 128
           +  ++F+
Sbjct: 142 LSYISFQ 148



 Score =  120 bits (302), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 37/123 (30%), Positives = 57/123 (46%), Gaps = 12/123 (9%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAE 68
           L P + + + G V   A+ F +NL  G       NPRF    D N +V N++   +WG+E
Sbjct: 203 LYPSKSILLSGTVLPSAQRFHINLCSGNHIAFHLNPRF----DENAVVRNTQIDNSWGSE 258

Query: 69  QRE--SAFPFQPGSVV---EVFNQTDLTIKLPDGYEFKFPNRL-NLEAINYLSAGGDFKI 122
           +R      PF  G       +     L + +   + F++ +RL NL  IN L  GGD ++
Sbjct: 259 ERSLPRKMPFVRGQSFSVWILCEAHCLKVAVDGQHLFEYYHRLRNLPTINRLEVGGDIQL 318

Query: 123 KCV 125
             V
Sbjct: 319 THV 321


>ref|NP_002299.2| galectin-9 isoform short [Homo sapiens]
 dbj|BAB83624.1| galectin-9 [Homo sapiens]
 gb|AAI05943.1| Lectin, galactoside-binding, soluble, 9 [Homo sapiens]
 gb|AAI05945.1| Lectin, galactoside-binding, soluble, 9 [Homo sapiens]
 gb|AAI10341.1| Lectin, galactoside-binding, soluble, 9 [Homo sapiens]
 gb|EAW51037.1| lectin, galactoside-binding, soluble, 9 (galectin 9), isoform CRA_a
           [Homo sapiens]
 gb|EAW51043.1| lectin, galactoside-binding, soluble, 9 (galectin 9), isoform CRA_a
           [Homo sapiens]
 dbj|BAF76327.1| urate transporter/channel protein [Homo sapiens]
          Length = 323

 Score =  144 bits (365), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 31/127 (24%), Positives = 60/127 (47%), Gaps = 12/127 (9%)

Query: 11  LKPGECLRVRGEVAADA-KSFLLNL-----GKDDNNLCNPRFNAHGDVNTIVCNSKDAGA 64
           L+ G  + V G V + +   F +N      G D     NPRF    D   +VCN++  G+
Sbjct: 25  LQDGLQITVNGTVLSSSGTRFAVNFQTGFSGNDIAFHFNPRFE---DGGYVVCNTRQNGS 81

Query: 65  WGAEQRESAFPFQPGSVVE---VFNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFK 121
           WG E+R++  PFQ G   +   +   +D  + +      ++ +R+    ++ +S  G  +
Sbjct: 82  WGPEERKTHMPFQKGMPFDLCFLVQSSDFKVMVNGILFVQYFHRVPFHRVDTISVNGSVQ 141

Query: 122 IKCVAFE 128
           +  ++F+
Sbjct: 142 LSYISFQ 148



 Score =  120 bits (302), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 37/123 (30%), Positives = 57/123 (46%), Gaps = 12/123 (9%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAE 68
           L P + + + G V   A+ F +NL  G       NPRF    D N +V N++   +WG+E
Sbjct: 203 LYPSKSILLSGTVLPSAQRFHINLCSGNHIAFHLNPRF----DENAVVRNTQIDNSWGSE 258

Query: 69  QRE--SAFPFQPGSVV---EVFNQTDLTIKLPDGYEFKFPNRL-NLEAINYLSAGGDFKI 122
           +R      PF  G       +     L + +   + F++ +RL NL  IN L  GGD ++
Sbjct: 259 ERSLPRKMPFVRGQSFSVWILCEAHCLKVAVDGQHLFEYYHRLRNLPTINRLEVGGDIQL 318

Query: 123 KCV 125
             V
Sbjct: 319 THV 321


>gb|ABJ80692.1| beta-galactoside-binding lectin [Hippoglossus hippoglossus]
          Length = 134

 Score =  144 bits (364), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 48/131 (36%), Positives = 71/131 (54%), Gaps = 6/131 (4%)

Query: 4   LVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNN---LCNPRFNAHGDVNTIVCNSK 60
           ++  N++ K G+ L + G    DA +F LN+G  D +     NPRFNAHGD N +VCNS 
Sbjct: 4   MMVKNMSFKVGQTLTLVGVAKPDATNFALNIGSSDQDIVMHINPRFNAHGDENAVVCNSY 63

Query: 61  DAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAG 117
             G W  E RE  FPFQ G   ++   F   +  + L DG    FPNR+  E  +++S  
Sbjct: 64  IGGQWCEELREGGFPFQLGQEFKITIEFTPQEFLVTLSDGSNIHFPNRIGAEKYSFMSFE 123

Query: 118 GDFKIKCVAFE 128
           G+ +I+ +  +
Sbjct: 124 GEARIRSIEIK 134


>ref|XP_001148447.1| PREDICTED: galectin 9 isoform 1 [Pan troglodytes]
          Length = 304

 Score =  144 bits (364), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 31/127 (24%), Positives = 60/127 (47%), Gaps = 12/127 (9%)

Query: 11  LKPGECLRVRGEVAADA-KSFLLNL-----GKDDNNLCNPRFNAHGDVNTIVCNSKDAGA 64
           L+ G  + V G V + +   F +N      G D     NPRF    D   +VCN++  G+
Sbjct: 25  LQDGLQITVNGTVLSSSGTRFAVNFQTGFSGNDIAFHFNPRFE---DGGYVVCNTRQNGS 81

Query: 65  WGAEQRESAFPFQPGSVVE---VFNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFK 121
           WG E+R++  PFQ G   +   +   +D  + +      ++ +R+    ++ +S  G  +
Sbjct: 82  WGPEERKTHMPFQKGMPFDLCFLVQSSDFKVMVNGSLFVQYFHRVPFHRVDTISINGSVQ 141

Query: 122 IKCVAFE 128
           +  ++F+
Sbjct: 142 LSYISFQ 148



 Score =  112 bits (280), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 37/122 (30%), Positives = 54/122 (44%), Gaps = 12/122 (9%)

Query: 12  KPGECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAEQ 69
            P     + G V   A+ F +NL  G       NPRF    D N +V N++   +WG+E+
Sbjct: 185 HPXXXXXLSGTVLPSAQRFHINLCSGSHIAFHLNPRF----DENAVVRNTQINNSWGSEE 240

Query: 70  RE--SAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRL-NLEAINYLSAGGDFKIK 123
           R      PF  G    V        L + +   + F++ +RL NL  IN L  GGD ++ 
Sbjct: 241 RSLPRKMPFVRGQSFLVWILCEAHCLKVAVDGQHVFEYYHRLRNLPTINKLEVGGDIQLT 300

Query: 124 CV 125
            V
Sbjct: 301 HV 302


>gb|EAW51042.1| lectin, galactoside-binding, soluble, 9 (galectin 9), isoform CRA_e
           [Homo sapiens]
          Length = 343

 Score =  143 bits (363), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 31/127 (24%), Positives = 60/127 (47%), Gaps = 12/127 (9%)

Query: 11  LKPGECLRVRGEVAADA-KSFLLNL-----GKDDNNLCNPRFNAHGDVNTIVCNSKDAGA 64
           L+ G  + V G V + +   F +N      G D     NPRF    D   +VCN++  G+
Sbjct: 25  LQDGLQITVNGTVLSSSGTRFAVNFQTGFSGNDIAFHFNPRFE---DGGYVVCNTRQNGS 81

Query: 65  WGAEQRESAFPFQPGSVVE---VFNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFK 121
           WG E+R++  PFQ G   +   +   +D  + +      ++ +R+    ++ +S  G  +
Sbjct: 82  WGPEERKTHMPFQKGMPFDLCFLVQSSDFKVMVNGILFVQYFHRVPFHRVDTISVNGSVQ 141

Query: 122 IKCVAFE 128
           +  ++F+
Sbjct: 142 LSYISFQ 148



 Score =  120 bits (301), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 37/123 (30%), Positives = 57/123 (46%), Gaps = 12/123 (9%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAE 68
           L P + + + G V   A+ F +NL  G       NPRF    D N +V N++   +WG+E
Sbjct: 223 LYPSKSILLSGTVLPSAQRFHINLCSGNHIAFHLNPRF----DENAVVRNTQIDNSWGSE 278

Query: 69  QRE--SAFPFQPGSVV---EVFNQTDLTIKLPDGYEFKFPNRL-NLEAINYLSAGGDFKI 122
           +R      PF  G       +     L + +   + F++ +RL NL  IN L  GGD ++
Sbjct: 279 ERSLPRKMPFVRGQSFSVWILCEAHCLKVAVDGQHLFEYYHRLRNLPTINRLEVGGDIQL 338

Query: 123 KCV 125
             V
Sbjct: 339 THV 341


>gb|EAW80661.1| hCG22119, isoform CRA_c [Homo sapiens]
          Length = 264

 Score =  143 bits (363), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 37/134 (27%), Positives = 61/134 (45%), Gaps = 11/134 (8%)

Query: 4   LVASNLNL----KPGECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVC 57
           +V  NL L     P   + + G V  +A    L+   G D     NPRFN + +   IVC
Sbjct: 129 IVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNEN-NRRVIVC 187

Query: 58  NSKDAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRL-NLEAINY 113
           N+K    WG E+R+S FPF+ G   ++          + + D +  ++ +R+  L  I+ 
Sbjct: 188 NTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISK 247

Query: 114 LSAGGDFKIKCVAF 127
           L   GD  +   ++
Sbjct: 248 LGISGDIDLTSASY 261


>ref|XP_001148424.1| PREDICTED: similar to galactose-specific lectin [Pan troglodytes]
          Length = 357

 Score =  143 bits (363), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 37/134 (27%), Positives = 62/134 (46%), Gaps = 11/134 (8%)

Query: 4   LVASNLNL----KPGECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVC 57
           +V  NL L     P   + + G V  +A    L+   G D     NPRFN + +   IVC
Sbjct: 222 IVPYNLPLPGGVVPRMLITILGSVKPNANRIALDFQRGNDVAFHFNPRFNEN-NRRVIVC 280

Query: 58  NSKDAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRL-NLEAINY 113
           N+K    WG E+R+S FPF+ G   ++          + + D +  ++ +R+  L  I+ 
Sbjct: 281 NTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISK 340

Query: 114 LSAGGDFKIKCVAF 127
           L+  GD  +   ++
Sbjct: 341 LAISGDIDLTSASY 354


>ref|NP_002297.2| galectin 3 [Homo sapiens]
 sp|P17931|LEG3_HUMAN RecName: Full=Galectin-3; AltName: Full=Galactose-specific lectin
           3; AltName: Full=Mac-2 antigen; AltName:
           Full=IgE-binding protein; AltName: Full=35 kDa lectin;
           AltName: Full=Carbohydrate-binding protein 35; Short=CBP
           35; AltName: Full=Laminin-binding protein; AltName:
           Full=Lectin L-29; AltName: Full=L-31; AltName:
           Full=Galactoside-binding protein; Short=GALBP
 gb|AAB26229.1| carbohydrate binding protein 35; Mac-2; CBP 35 [Homo sapiens]
 dbj|BAA22164.1| galectin-3 [Homo sapiens]
 gb|AAB86584.1| galectin 3 [Homo sapiens]
 gb|AAH01120.1| Lectin, galactoside-binding, soluble, 3 [Homo sapiens]
 emb|CAG33178.1| LGALS3 [Homo sapiens]
 gb|EAW80658.1| hCG22119, isoform CRA_a [Homo sapiens]
 gb|EAW80660.1| hCG22119, isoform CRA_a [Homo sapiens]
 gb|ABM83520.1| lectin, galactoside-binding, soluble, 3 (galectin 3) [synthetic
           construct]
 gb|ABW03507.1| lectin, galactoside-binding, soluble, 3 [synthetic construct]
          Length = 250

 Score =  143 bits (363), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 37/134 (27%), Positives = 61/134 (45%), Gaps = 11/134 (8%)

Query: 4   LVASNLNL----KPGECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVC 57
           +V  NL L     P   + + G V  +A    L+   G D     NPRFN + +   IVC
Sbjct: 115 IVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNEN-NRRVIVC 173

Query: 58  NSKDAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRL-NLEAINY 113
           N+K    WG E+R+S FPF+ G   ++          + + D +  ++ +R+  L  I+ 
Sbjct: 174 NTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISK 233

Query: 114 LSAGGDFKIKCVAF 127
           L   GD  +   ++
Sbjct: 234 LGISGDIDLTSASY 247


>ref|XP_001497400.2| PREDICTED: similar to Galectin-4 (Lactose-binding lectin 4) (L-36
           lactose-binding protein) (L36LBP) (Antigen NY-CO-27)
           isoform 1 [Equus caballus]
          Length = 324

 Score =  143 bits (363), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 32/126 (25%), Positives = 58/126 (46%), Gaps = 12/126 (9%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL------GKDDNNLCNPRFNAHGDVNTIVCNSKDAGA 64
           L  G  + ++G  +   K F +N       G D     NPRF+    ++ +V NS+  G 
Sbjct: 27  LSVGMSVYIQGVPSEHMKRFFVNFAVGQSPGSDIAFHFNPRFDG---LDKVVFNSQQGGH 83

Query: 65  WGAEQRESAFPFQPGSVVEVFNQ---TDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFK 121
           WG E+R+   PF+ G   E+          + +     ++F +RL L+ + +L   GD +
Sbjct: 84  WGKEERKREMPFRKGCPFELVFMILPEHYKVVVNGNSFYEFGHRLPLQMVTHLQVDGDVQ 143

Query: 122 IKCVAF 127
           ++ + F
Sbjct: 144 LQSINF 149



 Score =  109 bits (273), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 28/120 (23%), Positives = 50/120 (41%), Gaps = 5/120 (4%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNLGKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAEQR 70
           L P   + ++G V   +KSF++N     +       N       +V NS   G+WG+E+R
Sbjct: 203 LTPRRTIIIKGFVPPSSKSFVINFKVGSSGDVALHMNPRLSEGIVVRNSFLNGSWGSEER 262

Query: 71  E-SAFPFQPGSVVEVFNQTD---LTIKLPDGYEFKFPNRLN-LEAINYLSAGGDFKIKCV 125
                PF+ G   ++  +       +     + F F +RL   + ++ L   GD  +  V
Sbjct: 263 RIPHNPFRAGQYFDLSIRCGTDRFKVFANGQHLFDFSHRLPAFQRVDVLEIQGDVTLSYV 322


>gb|AAA88086.1| galactose-specific lectin [Homo sapiens]
          Length = 250

 Score =  143 bits (363), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 37/134 (27%), Positives = 61/134 (45%), Gaps = 11/134 (8%)

Query: 4   LVASNLNL----KPGECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVC 57
           +V  NL L     P   + + G V  +A    L+   G D     NPRFN + +   IVC
Sbjct: 115 IVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNEN-NRRVIVC 173

Query: 58  NSKDAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRL-NLEAINY 113
           N+K    WG E+R+S FPF+ G   ++          + + D +  ++ +R+  L  I+ 
Sbjct: 174 NTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISK 233

Query: 114 LSAGGDFKIKCVAF 127
           L   GD  +   ++
Sbjct: 234 LGISGDIDLTSASY 247


>sp|Q9CQW5|LEG2_MOUSE RecName: Full=Galectin-2
 dbj|BAB24987.1| unnamed protein product [Mus musculus]
 dbj|BAB25797.1| unnamed protein product [Mus musculus]
          Length = 130

 Score =  143 bits (363), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 53/126 (42%), Positives = 74/126 (58%), Gaps = 5/126 (3%)

Query: 6   ASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNLCNPRFNAHGDVNTIVCNSKDAGAW 65
             +LN+KPG  L+++G++  D   FL+NLG+    L N  FN   D +TIVCN+ + G W
Sbjct: 7   VKDLNMKPGMSLKIKGKIHNDVDRFLINLGQGKETL-NLHFNPRFDESTIVCNTSEGGRW 65

Query: 66  GAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFKI 122
           G EQRE+   F PGS V++   F   D  + LPDG++  FPNRL    ++YLS GG  +I
Sbjct: 66  GQEQRENHMCFSPGSEVKITITFQDKDFKVTLPDGHQLTFPNRLGHNQLHYLSMGG-LQI 124

Query: 123 KCVAFE 128
                E
Sbjct: 125 SSFKLE 130


>ref|NP_114020.1| galectin 3 [Rattus norvegicus]
 gb|AAA40828.1| IgE binding protein
          Length = 262

 Score =  143 bits (362), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 39/132 (29%), Positives = 62/132 (46%), Gaps = 11/132 (8%)

Query: 5   VASNLNL----KPGECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVCN 58
           V  ++ L     P   + + G V  +A S  LN   G D     NPRFN + +   IVCN
Sbjct: 128 VPYDMPLPGGVMPRMLITIIGTVKPNANSITLNFKKGNDIAFHFNPRFNEN-NRRVIVCN 186

Query: 59  SKDAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRL-NLEAINYL 114
           +K    WG E+R+SAFPF+ G   ++          + + D +  ++ +R+ NL  I+ L
Sbjct: 187 TKQDNNWGREERQSAFPFESGKPFKIQVLVEADHFKVAVNDVHLLQYNHRMKNLREISQL 246

Query: 115 SAGGDFKIKCVA 126
              GD  +   +
Sbjct: 247 GIIGDITLTSAS 258


>ref|XP_001087063.1| PREDICTED: similar to lectin, galactoside-binding, soluble, 2
           [Macaca mulatta]
          Length = 132

 Score =  143 bits (362), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 52/128 (40%), Positives = 69/128 (53%), Gaps = 4/128 (3%)

Query: 4   LVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNLCNPRFNAHGDVNTIVCNSKDAG 63
           L   N+++KPG  L++ G +A  A  F++NLG+  + L N  FN     +TIVCNS D  
Sbjct: 5   LEVKNMDMKPGSTLKITGRIADGADGFVINLGQGTDKL-NLHFNPRFSESTIVCNSLDGS 63

Query: 64  AWGAEQRESAFPFQPGSVVE---VFNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDF 120
            WG EQRE    F PGS V+    F      +KLPDG+E  FPNRL    ++YLS  G F
Sbjct: 64  NWGQEQREDHLCFSPGSEVKFTVTFESDKFKVKLPDGHELTFPNRLGHSHLSYLSVRGGF 123

Query: 121 KIKCVAFE 128
                  +
Sbjct: 124 NTSSFKLK 131


>sp|P08699|LEG3_RAT RecName: Full=Galectin-3; AltName: Full=Galactose-specific lectin
           3; AltName: Full=Mac-2 antigen; AltName:
           Full=IgE-binding protein; AltName: Full=35 kDa lectin;
           AltName: Full=Carbohydrate-binding protein 35; Short=CBP
           35; AltName: Full=Laminin-binding protein; AltName:
           Full=Lectin L-29
 gb|AAH89054.1| Lectin, galactoside-binding, soluble, 3 [Rattus norvegicus]
 gb|EDL88350.1| lectin, galactose binding, soluble 3, isoform CRA_a [Rattus
           norvegicus]
          Length = 262

 Score =  143 bits (362), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 39/132 (29%), Positives = 62/132 (46%), Gaps = 11/132 (8%)

Query: 5   VASNLNL----KPGECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVCN 58
           V  ++ L     P   + + G V  +A S  LN   G D     NPRFN + +   IVCN
Sbjct: 128 VPYDMPLPGGVMPRMLITIIGTVKPNANSITLNFKKGNDIAFHFNPRFNEN-NRRVIVCN 186

Query: 59  SKDAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRL-NLEAINYL 114
           +K    WG E+R+SAFPF+ G   ++          + + D +  ++ +R+ NL  I+ L
Sbjct: 187 TKQDNNWGREERQSAFPFESGKPFKIQVLVEADHFKVAVNDVHLLQYNHRMKNLREISQL 246

Query: 115 SAGGDFKIKCVA 126
              GD  +   +
Sbjct: 247 GIIGDITLTSAS 258


>dbj|BAB83623.1| galectin-9 [Homo sapiens]
 gb|EAW51038.1| lectin, galactoside-binding, soluble, 9 (galectin 9), isoform CRA_b
           [Homo sapiens]
 gb|EAW51039.1| lectin, galactoside-binding, soluble, 9 (galectin 9), isoform CRA_b
           [Homo sapiens]
          Length = 311

 Score =  143 bits (362), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 31/127 (24%), Positives = 60/127 (47%), Gaps = 12/127 (9%)

Query: 11  LKPGECLRVRGEVAADA-KSFLLNL-----GKDDNNLCNPRFNAHGDVNTIVCNSKDAGA 64
           L+ G  + V G V + +   F +N      G D     NPRF    D   +VCN++  G+
Sbjct: 25  LQDGLQITVNGTVLSSSGTRFAVNFQTGFSGNDIAFHFNPRFE---DGGYVVCNTRQNGS 81

Query: 65  WGAEQRESAFPFQPGSVVE---VFNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFK 121
           WG E+R++  PFQ G   +   +   +D  + +      ++ +R+    ++ +S  G  +
Sbjct: 82  WGPEERKTHMPFQKGMPFDLCFLVQSSDFKVMVNGILFVQYFHRVPFHRVDTISVNGSVQ 141

Query: 122 IKCVAFE 128
           +  ++F+
Sbjct: 142 LSYISFQ 148



 Score =  119 bits (300), Expect = 7e-26,   Method: Composition-based stats.
 Identities = 37/123 (30%), Positives = 57/123 (46%), Gaps = 12/123 (9%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAE 68
           L P + + + G V   A+ F +NL  G       NPRF    D N +V N++   +WG+E
Sbjct: 191 LYPSKSILLSGTVLPSAQRFHINLCSGNHIAFHLNPRF----DENAVVRNTQIDNSWGSE 246

Query: 69  QRE--SAFPFQPGSVV---EVFNQTDLTIKLPDGYEFKFPNRL-NLEAINYLSAGGDFKI 122
           +R      PF  G       +     L + +   + F++ +RL NL  IN L  GGD ++
Sbjct: 247 ERSLPRKMPFVRGQSFSVWILCEAHCLKVAVDGQHLFEYYHRLRNLPTINRLEVGGDIQL 306

Query: 123 KCV 125
             V
Sbjct: 307 THV 309


>dbj|BAD92628.1| LGALS3 protein variant [Homo sapiens]
          Length = 258

 Score =  143 bits (362), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 37/134 (27%), Positives = 61/134 (45%), Gaps = 11/134 (8%)

Query: 4   LVASNLNL----KPGECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVC 57
           +V  NL L     P   + + G V  +A    L+   G D     NPRFN + +   IVC
Sbjct: 123 IVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNEN-NRRVIVC 181

Query: 58  NSKDAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRL-NLEAINY 113
           N+K    WG E+R+S FPF+ G   ++          + + D +  ++ +R+  L  I+ 
Sbjct: 182 NTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISK 241

Query: 114 LSAGGDFKIKCVAF 127
           L   GD  +   ++
Sbjct: 242 LGISGDIDLTSASY 255


>gb|AAA35607.1| IgE-binding protein
 gb|AAA36163.1| laminin-binding protein
 gb|AAH53667.1| Lectin, galactoside-binding, soluble, 3 [Homo sapiens]
 dbj|BAG37435.1| unnamed protein product [Homo sapiens]
          Length = 250

 Score =  143 bits (362), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 37/134 (27%), Positives = 61/134 (45%), Gaps = 11/134 (8%)

Query: 4   LVASNLNL----KPGECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVC 57
           +V  NL L     P   + + G V  +A    L+   G D     NPRFN + +   IVC
Sbjct: 115 IVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNEN-NRRVIVC 173

Query: 58  NSKDAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRL-NLEAINY 113
           N+K    WG E+R+S FPF+ G   ++          + + D +  ++ +R+  L  I+ 
Sbjct: 174 NTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISK 233

Query: 114 LSAGGDFKIKCVAF 127
           L   GD  +   ++
Sbjct: 234 LGISGDIDLTSASY 247


>sp|P38486|LEG3_CANFA RecName: Full=Galectin-3; AltName: Full=Galactose-specific lectin
           3; AltName: Full=Mac-2 antigen; AltName:
           Full=IgE-binding protein; AltName: Full=35 kDa lectin;
           AltName: Full=Carbohydrate-binding protein 35; Short=CBP
           35; AltName: Full=Laminin-binding protein; AltName:
           Full=Lectin L-29
          Length = 296

 Score =  143 bits (362), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 38/133 (28%), Positives = 61/133 (45%), Gaps = 11/133 (8%)

Query: 5   VASNLNL----KPGECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVCN 58
           V  +L L    KP   + + G V   A    L+   G D     NPRFN   +   IVCN
Sbjct: 162 VPYDLPLPGGVKPRMLITILGTVRPSANRLALDFKRGNDVAFHFNPRFNE-DNKRVIVCN 220

Query: 59  SKDAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRL-NLEAINYL 114
           +K    WG E+R++AFPF+ G   ++          + + D +  ++ +R+ NL  I+ L
Sbjct: 221 TKLDNIWGKEERQAAFPFESGKPFKIQVLVESDHFKVAVNDAHLLQYNHRMKNLPEISKL 280

Query: 115 SAGGDFKIKCVAF 127
              GD  +   ++
Sbjct: 281 GISGDIDLTSASY 293


>gb|AAA16211.1| beta-galactosides-binding lectin
          Length = 285

 Score =  143 bits (362), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 38/133 (28%), Positives = 61/133 (45%), Gaps = 11/133 (8%)

Query: 5   VASNLNL----KPGECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVCN 58
           V  +L L    KP   + + G V   A    L+   G D     NPRFN   +   IVCN
Sbjct: 151 VPYDLPLPGGVKPRMLITILGTVRPSANRLALDFKRGNDVAFHFNPRFNE-DNKRVIVCN 209

Query: 59  SKDAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRL-NLEAINYL 114
           +K    WG E+R++AFPF+ G   ++          + + D +  ++ +R+ NL  I+ L
Sbjct: 210 TKLDNIWGKEERQAAFPFESGKPFKIQVLVESDHFKVAVNDAHLLQYNHRMKNLPEISKL 269

Query: 115 SAGGDFKIKCVAF 127
              GD  +   ++
Sbjct: 270 GISGDIDLTSASY 282


>ref|XP_853675.1| PREDICTED: similar to Galectin-3 (Galactose-specific lectin 3)
           (Mac-2 antigen) (IgE-binding protein) (35 kDa lectin)
           (Carbohydrate binding protein 35) (CBP 35)
           (Laminin-binding protein) (Lectin L-29) (L-34
           galactoside-binding lectin) [Canis familiaris]
          Length = 287

 Score =  143 bits (362), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 38/133 (28%), Positives = 61/133 (45%), Gaps = 11/133 (8%)

Query: 5   VASNLNL----KPGECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVCN 58
           V  +L L    KP   + + G V   A    L+   G D     NPRFN   +   IVCN
Sbjct: 153 VPYDLPLPGGVKPRMLITILGTVRPSANRLALDFKRGNDVAFHFNPRFNE-DNKRVIVCN 211

Query: 59  SKDAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRL-NLEAINYL 114
           +K    WG E+R++AFPF+ G   ++          + + D +  ++ +R+ NL  I+ L
Sbjct: 212 TKLDNIWGKEERQAAFPFESGKPFKIQVLVESDHFKVAVNDAHLLQYNHRMKNLPEISKL 271

Query: 115 SAGGDFKIKCVAF 127
              GD  +   ++
Sbjct: 272 GISGDIDLTSASY 284


>emb|CAG46894.1| LGALS3 [Homo sapiens]
          Length = 250

 Score =  143 bits (361), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 37/134 (27%), Positives = 61/134 (45%), Gaps = 11/134 (8%)

Query: 4   LVASNLNL----KPGECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVC 57
           +V  NL L     P   + + G V  +A    L+   G D     NPRFN + +   IVC
Sbjct: 115 IVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNEN-NRRVIVC 173

Query: 58  NSKDAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRL-NLEAINY 113
           N+K    WG E+R+S FPF+ G   ++          + + D +  ++ +R+  L  I+ 
Sbjct: 174 NTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISK 233

Query: 114 LSAGGDFKIKCVAF 127
           L   GD  +   ++
Sbjct: 234 LGISGDIDLTSASY 247


>gb|AAX37050.1| lectin galactoside-binding soluble 3 [synthetic construct]
          Length = 251

 Score =  143 bits (361), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 37/134 (27%), Positives = 61/134 (45%), Gaps = 11/134 (8%)

Query: 4   LVASNLNL----KPGECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVC 57
           +V  NL L     P   + + G V  +A    L+   G D     NPRFN + +   IVC
Sbjct: 115 IVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNEN-NRRVIVC 173

Query: 58  NSKDAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRL-NLEAINY 113
           N+K    WG E+R+S FPF+ G   ++          + + D +  ++ +R+  L  I+ 
Sbjct: 174 NTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISK 233

Query: 114 LSAGGDFKIKCVAF 127
           L   GD  +   ++
Sbjct: 234 LGISGDIDLTSASY 247


>gb|AAM44060.1|AF510729_1 galectin-4 [Mus musculus]
          Length = 326

 Score =  143 bits (361), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 27/126 (21%), Positives = 57/126 (45%), Gaps = 12/126 (9%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL------GKDDNNLCNPRFNAHGDVNTIVCNSKDAGA 64
           L  G  + ++G    + + F +N       G D     NPRF+     + +V  +  +G 
Sbjct: 27  LSVGMSVYIQGMAKENMRRFHVNFAVGQDDGADVAFHFNPRFDGW---DKVVFKTMQSGQ 83

Query: 65  WGAEQRESAFPFQPGSVVEVFNQ---TDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFK 121
           WG E+++ + PFQ G   E+          + +     +++ +RL ++ + +L   GD +
Sbjct: 84  WGKEEKKKSMPFQKGKHFELVFMVMPEHYKVVVNGNSFYEYGHRLPVQMVTHLQVDGDLE 143

Query: 122 IKCVAF 127
           ++ + F
Sbjct: 144 LQSINF 149



 Score = 99.3 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 30/124 (24%), Positives = 54/124 (43%), Gaps = 14/124 (11%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL----GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWG 66
           L     + ++G V   A++F++N       D     NPR       +++V NS   G+WG
Sbjct: 206 LTVRRTIIIKGYVLPTARNFVINFKVGSSGDIALHLNPRI-----GDSVVRNSFMNGSWG 260

Query: 67  AEQRE-SAFPFQPGSVVEVFNQTD---LTIKLPDGYEFKFPNRL-NLEAINYLSAGGDFK 121
           AE+R+ +  PF PG   ++  +       +     + F F +R    + ++ L   GD  
Sbjct: 261 AEERKVAYNPFGPGQFFDLSIRCGMDRFKVFANGQHLFDFSHRFQAFQMVDTLEINGDIT 320

Query: 122 IKCV 125
           +  V
Sbjct: 321 LSYV 324


>gb|AAH68068.1| Lectin, galactoside-binding, soluble, 3 [Homo sapiens]
          Length = 250

 Score =  143 bits (361), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 37/134 (27%), Positives = 61/134 (45%), Gaps = 11/134 (8%)

Query: 4   LVASNLNL----KPGECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVC 57
           +V  NL L     P   + + G V  +A    L+   G D     NPRFN + +   IVC
Sbjct: 115 IVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNEN-NRRVIVC 173

Query: 58  NSKDAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRL-NLEAINY 113
           N+K    WG E+R+S FPF+ G   ++          + + D +  ++ +R+  L  I+ 
Sbjct: 174 NTKLDNNWGREERQSVFPFESGKPFKIHVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISK 233

Query: 114 LSAGGDFKIKCVAF 127
           L   GD  +   ++
Sbjct: 234 LGISGDIDLTSASY 247


>gb|AAA37311.1| carbohydrate binding protein 35
          Length = 263

 Score =  143 bits (361), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 37/132 (28%), Positives = 60/132 (45%), Gaps = 11/132 (8%)

Query: 5   VASNLNL----KPGECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVCN 58
           V  +L L     P   + + G V  +A   +L+   G D     NPRFN + +   IVCN
Sbjct: 129 VPYDLPLPGGVMPRMLITIMGTVKPNANRIVLDFRRGNDVAFHFNPRFNEN-NRRVIVCN 187

Query: 59  SKDAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRL-NLEAINYL 114
           +K    WG E+R+SAFPF+ G   ++          + + D +  ++ +R+ NL  I+ L
Sbjct: 188 TKQDNNWGKEERQSAFPFESGKPFKIQVLVEADHFKVAVNDAHLLQYNHRMKNLREISQL 247

Query: 115 SAGGDFKIKCVA 126
               D  +    
Sbjct: 248 GISRDITLTSAN 259


>pdb|1GAN|A Chain A, Complex Of Toad Ovary Galectin With N-Acetylgalactose
 pdb|1GAN|B Chain B, Complex Of Toad Ovary Galectin With N-Acetylgalactose
          Length = 134

 Score =  142 bits (360), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 61/134 (45%), Positives = 82/134 (61%), Gaps = 7/134 (5%)

Query: 1   ACGLVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNN---LCNPRFNAHGDVNTIVC 57
           + G+  +NLNLKPG C+ ++G +  D K F +NLG+D +N     N RF+ HGDVN IVC
Sbjct: 2   SAGVAVTNLNLKPGHCVEIKGSIPPDCKGFAVNLGEDASNFLLHFNARFDLHGDVNKIVC 61

Query: 58  NSKDAGAWGAEQRESAFPFQPGSVVEVFNQ---TDLTIKLPDGYEFKFPNRLNLEAINYL 114
           NSK+A AWG+EQRE  FPFQ G+ V V  +     + IK   G +F FP R  L +I +L
Sbjct: 62  NSKEADAWGSEQREGVFPFQQGAEVMVCFEYQTDKIIIKFSSGDQFSFPVRKVLPSIPFL 121

Query: 115 SAGGDFKIKCVAFE 128
           S  G  + K +  E
Sbjct: 122 SLEG-LQFKSITTE 134


>gb|EAW80659.1| hCG22119, isoform CRA_b [Homo sapiens]
          Length = 259

 Score =  142 bits (360), Expect = 7e-33,   Method: Composition-based stats.
 Identities = 37/134 (27%), Positives = 61/134 (45%), Gaps = 11/134 (8%)

Query: 4   LVASNLNL----KPGECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVC 57
           +V  NL L     P   + + G V  +A    L+   G D     NPRFN + +   IVC
Sbjct: 124 IVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNEN-NRRVIVC 182

Query: 58  NSKDAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRL-NLEAINY 113
           N+K    WG E+R+S FPF+ G   ++          + + D +  ++ +R+  L  I+ 
Sbjct: 183 NTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISK 242

Query: 114 LSAGGDFKIKCVAF 127
           L   GD  +   ++
Sbjct: 243 LGISGDIDLTSASY 256


>ref|NP_001075807.1| lectin, galactoside-binding, soluble, 3 [Oryctolagus cuniculus]
 sp|P47845|LEG3_RABIT RecName: Full=Galectin-3; AltName: Full=Galactose-specific lectin
           3; AltName: Full=Mac-2 antigen; AltName:
           Full=IgE-binding protein; AltName: Full=35 kDa lectin;
           AltName: Full=Carbohydrate-binding protein 35; Short=CBP
           35; AltName: Full=Laminin-binding protein; AltName:
           Full=Lectin L-29
 gb|AAC48491.1| galectin-3
          Length = 242

 Score =  142 bits (360), Expect = 8e-33,   Method: Composition-based stats.
 Identities = 37/133 (27%), Positives = 62/133 (46%), Gaps = 11/133 (8%)

Query: 4   LVASNLNL----KPGECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVC 57
            V  +L L     P   + + G V  +A    L+   G D     NPRFN + +   IVC
Sbjct: 107 PVPYDLPLPGGVMPRMLITIVGTVKPNANRLALDFKRGNDVAFHFNPRFNEN-NRRVIVC 165

Query: 58  NSKDAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRL-NLEAINY 113
           N+K    WG E+R++ FPF+ G   ++          + + D +  ++ +R+ NL+ IN 
Sbjct: 166 NTKVDNNWGREERQTTFPFEIGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRMRNLKEINK 225

Query: 114 LSAGGDFKIKCVA 126
           L   GD ++   +
Sbjct: 226 LGISGDIQLTSAS 238


>dbj|BAE43211.1| unnamed protein product [Mus musculus]
          Length = 186

 Score =  142 bits (360), Expect = 8e-33,   Method: Composition-based stats.
 Identities = 38/132 (28%), Positives = 61/132 (46%), Gaps = 11/132 (8%)

Query: 5   VASNLNL----KPGECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVCN 58
           V  +L L     P   + + G V  +A   +L+   G D     NPRFN + +   IVCN
Sbjct: 52  VPYDLPLPGGVMPRMLITIMGTVKPNANRIVLDFRRGNDVAFHFNPRFNEN-NRRVIVCN 110

Query: 59  SKDAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRL-NLEAINYL 114
           +K    WG E+R+SAFPF+ G   ++          + + D +  ++ +R+ NL  I+ L
Sbjct: 111 TKQDNNWGKEERQSAFPFESGKPFKIQVLVEADHFKVAVNDAHLLQYNHRMKNLREISQL 170

Query: 115 SAGGDFKIKCVA 126
              GD  +    
Sbjct: 171 GISGDITLTSAN 182


>emb|CAG04110.1| unnamed protein product [Tetraodon nigroviridis]
          Length = 132

 Score =  142 bits (360), Expect = 8e-33,   Method: Composition-based stats.
 Identities = 47/129 (36%), Positives = 69/129 (53%), Gaps = 6/129 (4%)

Query: 2   CGLVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNN---LCNPRFNAHGDVNTIVCN 58
            GL+  N++ K G+ + + G  + DA +F +N+ +++       N RFNAHGD N +VCN
Sbjct: 4   SGLIVKNMSFKVGQTMTIVGVPSPDASNFAINICQNEQEITMHFNARFNAHGDENKVVCN 63

Query: 59  SKDAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYLS 115
           S   G W  E RE  FPF+ G   ++   F   +  +KL DG    FPNR+  E    L+
Sbjct: 64  SYQGGNWCGEVREGGFPFRQGEEFQLTIEFTPAEFLVKLSDGSVIHFPNRVGAEKYALLN 123

Query: 116 AGGDFKIKC 124
             GD +IK 
Sbjct: 124 FDGDVRIKG 132


>ref|NP_001090970.1| lectin, galactoside-binding, soluble, 3 [Sus scrofa]
 gb|ABN15099.1| lectin galactoside-binding soluble 3 [Sus scrofa]
          Length = 260

 Score =  142 bits (360), Expect = 8e-33,   Method: Composition-based stats.
 Identities = 37/132 (28%), Positives = 58/132 (43%), Gaps = 11/132 (8%)

Query: 5   VASNLNL----KPGECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVCN 58
           V  +L L     P   + + G V  +A    L+   G D     NPRFN   +   IVCN
Sbjct: 126 VPYDLPLPGGVMPRMLITILGTVKPNANRLALDFKKGNDVAFHFNPRFNE-DNRRVIVCN 184

Query: 59  SKDAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRL-NLEAINYL 114
           SK    WG E+R+  FPF+ G   ++          + + D +  ++ +R+ NL  I+ L
Sbjct: 185 SKLDNNWGREERQMVFPFECGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRMRNLREISKL 244

Query: 115 SAGGDFKIKCVA 126
              GD  +   +
Sbjct: 245 GISGDITLTSAS 256


>dbj|BAB25661.1| unnamed protein product [Mus musculus]
          Length = 130

 Score =  142 bits (359), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 52/126 (41%), Positives = 73/126 (57%), Gaps = 5/126 (3%)

Query: 6   ASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNLCNPRFNAHGDVNTIVCNSKDAGAW 65
             +LN+KPG  L+++G++  D   FL+NLG+    L N  FN   D +TIVCN+ + G W
Sbjct: 7   VKDLNMKPGMSLKIKGKIHNDVDRFLINLGQGKETL-NLHFNPRFDESTIVCNTSEGGRW 65

Query: 66  GAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFKI 122
           G EQRE+   F PGS V++   F   D  + LPDG++  F NRL    ++YLS GG  +I
Sbjct: 66  GQEQRENHMCFSPGSEVKITITFQDKDFKVTLPDGHQLTFRNRLGHNQLHYLSMGG-LQI 124

Query: 123 KCVAFE 128
                E
Sbjct: 125 SSFKLE 130


>ref|NP_001117663.1| galectin like protein [Oncorhynchus mykiss]
 dbj|BAA88670.1| galectin like protein [Oncorhynchus mykiss]
          Length = 341

 Score =  142 bits (358), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 35/127 (27%), Positives = 60/127 (47%), Gaps = 11/127 (8%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL------GKDDNNLCNPRFNAHGDVNTIVCNSKDAGA 64
           L+ G+ + + G V   A  F +NL      G D     NPR+++H     +V N+     
Sbjct: 24  LQEGKTITITGRVHHGADRFHVNLQCGSRAGADIALHFNPRYDSHP--GYVVTNTLQQSK 81

Query: 65  WGAEQRESAFPFQPGSVV--EVFNQTDLTI-KLPDGYEFKFPNRLNLEAINYLSAGGDFK 121
           WG E+R+   PFQ GS    E+  Q D    K+   +   F +R+   +++ +SA G  +
Sbjct: 82  WGTEERKQHSPFQRGSSFSLEITVQRDFFQLKVNGNHFMTFKHRIPFYSVDTISADGKVE 141

Query: 122 IKCVAFE 128
           +  + F+
Sbjct: 142 LTSIVFQ 148



 Score =  123 bits (309), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 34/124 (27%), Positives = 49/124 (39%), Gaps = 10/124 (8%)

Query: 8   NLNLKPGECLRVRGEVAADAKSFLLNLG--KDDNNLCNPRFNAHGDVNTIVCNSKDAGAW 65
           N  L PG  + ++G V  +A  F +NL          NPRF+       +V NSK    W
Sbjct: 220 NGGLYPGRTINIQGVVNPNANRFHINLLFNSGIALHFNPRFDETL----VVRNSKLRDQW 275

Query: 66  GAEQRESAFPFQPGSVVEVFNQTD---LTIKLPDGYEFKFPNRLN-LEAINYLSAGGDFK 121
           G E+R    PF  G    +    D     I +       + +R   L+ +N L   GD  
Sbjct: 276 GKEERSGGMPFHRGQAFTLSITCDAQCYKIVVNGNQTSTYKHRHTLLQQVNILEVDGDLS 335

Query: 122 IKCV 125
           +  V
Sbjct: 336 LTSV 339


>dbj|BAF98709.1| unnamed protein product [Homo sapiens]
          Length = 356

 Score =  142 bits (358), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 30/127 (23%), Positives = 57/127 (44%), Gaps = 12/127 (9%)

Query: 11  LKPGECLRVRGEVAA-DAKSFLLNL-----GKDDNNLCNPRFNAHGDVNTIVCNSKDAGA 64
           L+ G  + V G V +     F ++      G D     NPRF    D   +VCN++  G 
Sbjct: 25  LQDGFQITVNGAVLSCSGTRFAVDFQTGFSGNDIAFHFNPRFE---DGGYVVCNTRQKGR 81

Query: 65  WGAEQRESAFPFQPGSVVE---VFNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFK 121
           WG E+R+   PFQ G   +   +   +D  + +      ++ +R+    ++ +S  G  +
Sbjct: 82  WGPEERKMHMPFQKGMPFDLCFLVQSSDFKVMVNGSLFVQYFHRMPFHRVDTISVNGSVQ 141

Query: 122 IKCVAFE 128
           +  ++F+
Sbjct: 142 LSYISFQ 148



 Score =  119 bits (300), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 37/123 (30%), Positives = 57/123 (46%), Gaps = 12/123 (9%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAE 68
           L P + + + G V   A+ F +NL  G       NPRF    D N +V N++   +WG+E
Sbjct: 236 LYPSKSIILSGTVLPSAQRFHINLCSGSHIAFHMNPRF----DENAVVRNTQINNSWGSE 291

Query: 69  QRE--SAFPFQPGSVV---EVFNQTDLTIKLPDGYEFKFPNRL-NLEAINYLSAGGDFKI 122
           +R      PF  G       +     L + +   + F++ +RL NL  IN L  GGD ++
Sbjct: 292 ERSLPRKMPFVRGQCFSVWILCEAHCLKVAVDGQHVFEYYHRLRNLPTINKLEVGGDIQL 351

Query: 123 KCV 125
             V
Sbjct: 352 THV 354


>gb|ACH44733.1| putative galectin CG-16 [Taeniopygia guttata]
          Length = 135

 Score =  142 bits (358), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 62/132 (46%), Positives = 89/132 (67%), Gaps = 8/132 (6%)

Query: 3   GLVASN-LNLKPGECLRVRGEVAADAKSFLLNLGKDDNN---LCNPRFNAHGDVNTIVCN 58
           GL   + ++++PGEC++V+G++  DAK F +N+GKD N      NPRF+  GDVNT VCN
Sbjct: 4   GLACYDRVDVEPGECIKVKGKIQFDAKGFAVNVGKDSNTLMLHFNPRFDCQGDVNTFVCN 63

Query: 59  SKDAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYLS 115
           SK+ G WG E R++ FPFQ G  +E+   F++ +  +K P+   FKFPNRL +E I YL+
Sbjct: 64  SKEDGVWGEEDRKADFPFQHGDKIEICFSFDEAEAPVKFPEAE-FKFPNRLGMEKIEYLA 122

Query: 116 AGGDFKIKCVAF 127
             GDFK+K + F
Sbjct: 123 VEGDFKVKAIKF 134


>gb|AAX37150.1| lectin galactoside-binding soluble 2 [synthetic construct]
          Length = 133

 Score =  141 bits (357), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 51/128 (39%), Positives = 69/128 (53%), Gaps = 4/128 (3%)

Query: 4   LVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNLCNPRFNAHGDVNTIVCNSKDAG 63
           L   N+++KPG  L++ G +A     F++NLG+  + L N  FN     +TIVCNS D  
Sbjct: 5   LEVKNMDMKPGSTLKITGSIADGTDGFVINLGQGTDKL-NLHFNPRFSESTIVCNSLDGS 63

Query: 64  AWGAEQRESAFPFQPGSVVE---VFNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDF 120
            WG EQRE    F PGS V+    F      +KLPDG+E  FPNRL    ++YLS  G F
Sbjct: 64  NWGQEQREDHLCFSPGSEVKFTVTFESDKFKVKLPDGHELTFPNRLGHSHLSYLSVRGGF 123

Query: 121 KIKCVAFE 128
            +     +
Sbjct: 124 NMSSFKLK 131


>ref|NP_006489.1| lectin, galactoside-binding, soluble, 2 [Homo sapiens]
 sp|P05162|LEG2_HUMAN RecName: Full=Galectin-2; AltName: Full=Beta-galactoside-binding
           lectin L-14-II; AltName: Full=Lactose-binding lectin 2;
           AltName: Full=S-Lac lectin 2; AltName: Full=HL14
 gb|AAA59512.1| S-lac lectin
 gb|AAA59513.1| S-lac lectin
 emb|CAB42834.1| lectin, galactoside-binding, soluble, 2 [Homo sapiens]
 gb|AAH59782.1| Lectin, galactoside-binding, soluble, 2 [Homo sapiens]
 emb|CAG30398.1| LGALS2 [Homo sapiens]
 emb|CAG46770.1| LGALS2 [Homo sapiens]
 emb|CAG46797.1| LGALS2 [Homo sapiens]
 emb|CAK54542.1| LGALS2 [synthetic construct]
 emb|CAK54841.1| LGALS2 [synthetic construct]
 gb|EAW60167.1| lectin, galactoside-binding, soluble, 2 (galectin 2) [Homo sapiens]
          Length = 132

 Score =  141 bits (357), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 51/128 (39%), Positives = 69/128 (53%), Gaps = 4/128 (3%)

Query: 4   LVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNLCNPRFNAHGDVNTIVCNSKDAG 63
           L   N+++KPG  L++ G +A     F++NLG+  + L N  FN     +TIVCNS D  
Sbjct: 5   LEVKNMDMKPGSTLKITGSIADGTDGFVINLGQGTDKL-NLHFNPRFSESTIVCNSLDGS 63

Query: 64  AWGAEQRESAFPFQPGSVVE---VFNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDF 120
            WG EQRE    F PGS V+    F      +KLPDG+E  FPNRL    ++YLS  G F
Sbjct: 64  NWGQEQREDHLCFSPGSEVKFTVTFESDKFKVKLPDGHELTFPNRLGHSHLSYLSVRGGF 123

Query: 121 KIKCVAFE 128
            +     +
Sbjct: 124 NMSSFKLK 131


>dbj|BAG58923.1| unnamed protein product [Homo sapiens]
          Length = 141

 Score =  141 bits (357), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 28/122 (22%), Positives = 57/122 (46%), Gaps = 12/122 (9%)

Query: 15  ECLRVRGEVAADAKSFLLNL------GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAE 68
             + ++G  +   K F +N       G D     NPRF+     + +V N+   G WG+E
Sbjct: 1   MSVYIQGVASEHMKRFFVNFVVGQDPGSDVAFHFNPRFDGW---DKVVFNTLQGGKWGSE 57

Query: 69  QRESAFPFQPGSVVE---VFNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFKIKCV 125
           +R+ + PF+ G+  E   +       + +     +++ +RL L+ + +L   GD +++ +
Sbjct: 58  ERKRSMPFKKGAAFELVFIVLAEHYKVVVNGNPFYEYGHRLPLQMVTHLQVDGDLQLQSI 117

Query: 126 AF 127
            F
Sbjct: 118 NF 119


>ref|XP_001156690.1| PREDICTED: hypothetical protein isoform 2 [Pan troglodytes]
          Length = 355

 Score =  141 bits (357), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 30/127 (23%), Positives = 58/127 (45%), Gaps = 12/127 (9%)

Query: 11  LKPGECLRVRGEVAADA-KSFLLNL-----GKDDNNLCNPRFNAHGDVNTIVCNSKDAGA 64
           L+ G  + V G V + +   F ++      G D     NPRF    D   +VCN++  G 
Sbjct: 25  LQDGFQITVNGAVLSSSGTRFAVDFQTGFSGNDIAFHFNPRFE---DGGYVVCNTRQKGR 81

Query: 65  WGAEQRESAFPFQPGSVVE---VFNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFK 121
           WG E+R+   PFQ G   +   +   +D  + +      ++ +R+    ++ +S  G  +
Sbjct: 82  WGPEERKMHMPFQKGMPFDLCFLVQSSDFKVMVNGSLFVQYFHRVPFHRVDTISVNGSVQ 141

Query: 122 IKCVAFE 128
           +  ++F+
Sbjct: 142 LSYISFQ 148



 Score =  121 bits (304), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 37/123 (30%), Positives = 57/123 (46%), Gaps = 12/123 (9%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAE 68
           L P + + + G V   A+ F +NL  G       NPRF    D N +V N++   +WG+E
Sbjct: 235 LYPSKSIILSGTVLPSAQRFHINLCSGSHIAFHMNPRF----DENAVVRNTQINNSWGSE 290

Query: 69  QRE--SAFPFQPGSVV---EVFNQTDLTIKLPDGYEFKFPNRL-NLEAINYLSAGGDFKI 122
           +R      PF  G       +     L + +   + F++ +RL NL  IN L  GGD ++
Sbjct: 291 ERSLPRKMPFVRGQSFSVWILCEAHCLKVAVDGQHVFEYYHRLRNLPTINKLEVGGDIQL 350

Query: 123 KCV 125
             V
Sbjct: 351 THV 353


>ref|XP_001504129.2| PREDICTED: similar to galectin 9 short isoform 3 [Equus caballus]
          Length = 358

 Score =  141 bits (357), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 33/127 (25%), Positives = 57/127 (44%), Gaps = 12/127 (9%)

Query: 11  LKPGECLRVRGEVAA-DAKSFLLNLG-----KDDNNLCNPRFNAHGDVNTIVCNSKDAGA 64
           L+ G  + V G +   +   F +N        D     NPRF    +   +VCN+K  G 
Sbjct: 25  LQDGLQITVIGTILPFNGTRFAVNFQIGSSDNDIAFHFNPRFE---NGGYLVCNTKQNGC 81

Query: 65  WGAEQRESAFPFQPGSVVE---VFNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFK 121
           WG E+R+   PFQ GS  E   +   +   + L      ++P+R+    ++ LS  G  +
Sbjct: 82  WGREERKMHLPFQRGSPFELIFLVQSSHFQVMLNGSPFVQYPHRVPFHRVDTLSINGIVQ 141

Query: 122 IKCVAFE 128
           +  ++F+
Sbjct: 142 LFSISFQ 148



 Score =  117 bits (294), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 40/123 (32%), Positives = 56/123 (45%), Gaps = 12/123 (9%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAE 68
           L P + + V G V   A+ F +NL  G D     NPRF    D NT+V N+   G+WG E
Sbjct: 238 LYPSKRIFVSGTVLPSAQRFHINLRSGSDIAFHLNPRF----DENTVVRNTHVNGSWGHE 293

Query: 69  QRE--SAFPFQPGSVVEVFNQTD---LTIKLPDGYEFKFPNRL-NLEAINYLSAGGDFKI 122
           +R      PF  G    V    +   L + +   +   + +RL NL  IN L   GD ++
Sbjct: 294 ERSLCGKMPFTRGQSFSVCITCEGHCLRVVVDGQHLCDYNHRLKNLPGINNLEVAGDVQL 353

Query: 123 KCV 125
             V
Sbjct: 354 TRV 356


>emb|CAB93851.1| galectin-9 [Homo sapiens]
          Length = 355

 Score =  141 bits (357), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 30/127 (23%), Positives = 58/127 (45%), Gaps = 12/127 (9%)

Query: 11  LKPGECLRVRGEVAADA-KSFLLNL-----GKDDNNLCNPRFNAHGDVNTIVCNSKDAGA 64
           L+ G  + V G V + +   F ++      G D     NPRF    D   +VCN++  G 
Sbjct: 25  LQDGLQITVNGTVLSSSGTRFAVDFQTGFSGNDIAFHFNPRFE---DGGYVVCNTRQKGR 81

Query: 65  WGAEQRESAFPFQPGSVVE---VFNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFK 121
           WG E+R+   PFQ G   +   +   +D  + +      ++ +R+    ++ +S  G  +
Sbjct: 82  WGPEERKMHMPFQKGMPFDLCFLVQSSDFKVMVNGILFVQYFHRVPFHRVDTISVNGSVQ 141

Query: 122 IKCVAFE 128
           +  ++F+
Sbjct: 142 LSYISFQ 148



 Score =  121 bits (305), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 37/123 (30%), Positives = 57/123 (46%), Gaps = 12/123 (9%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAE 68
           L P + + + G V   A+ F +NL  G       NPRF    D N +V N++   +WG+E
Sbjct: 235 LYPSKSILLSGTVLPSAQRFHINLCSGNHIAFHLNPRF----DENAVVRNTQIDNSWGSE 290

Query: 69  QRE--SAFPFQPGSVV---EVFNQTDLTIKLPDGYEFKFPNRL-NLEAINYLSAGGDFKI 122
           +R      PF  G       +     L + +   + F++ +RL NL  IN L  GGD ++
Sbjct: 291 ERSLPRKMPFVRGQSFSVWILCEAHCLKVAVDGQHVFEYYHRLRNLPTINKLEVGGDIQL 350

Query: 123 KCV 125
             V
Sbjct: 351 THV 353


>ref|XP_001156930.1| PREDICTED: hypothetical protein isoform 5 [Pan troglodytes]
          Length = 356

 Score =  141 bits (357), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 30/127 (23%), Positives = 58/127 (45%), Gaps = 12/127 (9%)

Query: 11  LKPGECLRVRGEVAADA-KSFLLNL-----GKDDNNLCNPRFNAHGDVNTIVCNSKDAGA 64
           L+ G  + V G V + +   F ++      G D     NPRF    D   +VCN++  G 
Sbjct: 25  LQDGFQITVNGAVLSSSGTRFAVDFQTGFSGNDIAFHFNPRFE---DGGYVVCNTRQKGR 81

Query: 65  WGAEQRESAFPFQPGSVVE---VFNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFK 121
           WG E+R+   PFQ G   +   +   +D  + +      ++ +R+    ++ +S  G  +
Sbjct: 82  WGPEERKMHMPFQKGMPFDLCFLVQSSDFKVMVNGSLFVQYFHRVPFHRVDTISVNGSVQ 141

Query: 122 IKCVAFE 128
           +  ++F+
Sbjct: 142 LSYISFQ 148



 Score =  120 bits (303), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 37/123 (30%), Positives = 57/123 (46%), Gaps = 12/123 (9%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAE 68
           L P + + + G V   A+ F +NL  G       NPRF    D N +V N++   +WG+E
Sbjct: 236 LYPSKSIILSGTVLPSAQRFHINLCSGSHIAFHMNPRF----DENAVVRNTQINNSWGSE 291

Query: 69  QRE--SAFPFQPGSVV---EVFNQTDLTIKLPDGYEFKFPNRL-NLEAINYLSAGGDFKI 122
           +R      PF  G       +     L + +   + F++ +RL NL  IN L  GGD ++
Sbjct: 292 ERSLPRKMPFVRGQSFSVWILCEAHCLKVAVDGQHVFEYYHRLRNLPTINKLEVGGDIQL 351

Query: 123 KCV 125
             V
Sbjct: 352 THV 354


>ref|XP_001499566.1| PREDICTED: similar to lectin, galactoside-binding, soluble, 2
           [Equus caballus]
          Length = 154

 Score =  141 bits (357), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 50/124 (40%), Positives = 74/124 (59%), Gaps = 4/124 (3%)

Query: 8   NLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGA 67
           N+++K G  L+++G++A DA+ F++NLG+  + L N  FN     +TIVCNS+D  +WG 
Sbjct: 32  NMDMKLGTTLKIKGKIANDAEGFVINLGQGADKL-NLHFNPRFCESTIVCNSRDGDSWGK 90

Query: 68  EQRESAFPFQPGSVVE---VFNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFKIKC 124
           EQRE+   F PGS V+    F      +KLPDG+   FPNRL    ++YLS  G F +  
Sbjct: 91  EQRENHICFSPGSEVKFTVTFESDGFKVKLPDGHLLTFPNRLGHSHLSYLSVQGGFSVCS 150

Query: 125 VAFE 128
              +
Sbjct: 151 FKLQ 154


>gb|AAC27245.1| galectin-4 [Mus musculus]
          Length = 300

 Score =  141 bits (357), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 27/126 (21%), Positives = 57/126 (45%), Gaps = 12/126 (9%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL------GKDDNNLCNPRFNAHGDVNTIVCNSKDAGA 64
           L  G  + ++G    + + F +N       G D     NPRF+     + +V  +  +G 
Sbjct: 6   LSVGMSVYIQGMAKENMRRFHVNFAVGQDDGADVAFHFNPRFDGW---DKVVFKTMQSGQ 62

Query: 65  WGAEQRESAFPFQPGSVVEVFNQ---TDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFK 121
           WG E+++ + PFQ G   E+          + +     +++ +RL ++ + +L   GD +
Sbjct: 63  WGKEEKKKSMPFQKGKHFELVFMVMPEHYKVVVNGNSFYEYGHRLPVQMVTHLQVDGDLE 122

Query: 122 IKCVAF 127
           ++ + F
Sbjct: 123 LQSINF 128



 Score = 92.8 bits (230), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 28/117 (23%), Positives = 52/117 (44%), Gaps = 14/117 (11%)

Query: 15  ECLRVRGEVAADAKSFLLNL----GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAEQR 70
             + ++G V   A++F++N       D     NPR       +++V NS   G+WGAE+R
Sbjct: 189 RTIIIKGYVLPTARNFVINFKVGSSGDIALHLNPRI-----GDSVVRNSFMNGSWGAEER 243

Query: 71  E-SAFPFQPGSVVEVFNQTD---LTIKLPDGYEFKFPNRL-NLEAINYLSAGGDFKI 122
           + +  PF PG   ++  +       +     + F F +R    + ++ L   GD  +
Sbjct: 244 KVAYNPFGPGQFFDLSIRCGMDRFKVFANGQHLFDFSHRFQAFQMVDTLEINGDITL 300


>gb|AAI05944.1| Lectin, galactoside-binding, soluble, 9B [Homo sapiens]
          Length = 356

 Score =  141 bits (356), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 30/127 (23%), Positives = 58/127 (45%), Gaps = 12/127 (9%)

Query: 11  LKPGECLRVRGEVAADA-KSFLLNL-----GKDDNNLCNPRFNAHGDVNTIVCNSKDAGA 64
           L+ G  + V G V + +   F ++      G D     NPRF    D   +VCN++  G 
Sbjct: 25  LQDGFQITVNGAVLSSSGTRFAVDFQTGFSGNDIAFHFNPRFE---DGGYVVCNTRQKGR 81

Query: 65  WGAEQRESAFPFQPGSVVE---VFNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFK 121
           WG E+R+   PFQ G   +   +   +D  + +      ++ +R+    ++ +S  G  +
Sbjct: 82  WGPEERKMHMPFQKGMPFDLCFLVQSSDFKVMVNGSLFVQYFHRVPFHRVDTISVNGSVQ 141

Query: 122 IKCVAFE 128
           +  ++F+
Sbjct: 142 LSYISFQ 148



 Score =  120 bits (303), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 37/123 (30%), Positives = 57/123 (46%), Gaps = 12/123 (9%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAE 68
           L P + + + G V   A+ F +NL  G       NPRF    D N +V N++   +WG+E
Sbjct: 236 LYPSKSIILSGTVLPSAQRFHINLCSGSHIAFHMNPRF----DENAVVRNTQINNSWGSE 291

Query: 69  QRE--SAFPFQPGSVV---EVFNQTDLTIKLPDGYEFKFPNRL-NLEAINYLSAGGDFKI 122
           +R      PF  G       +     L + +   + F++ +RL NL  IN L  GGD ++
Sbjct: 292 ERSLPRKMPFVRGQSFSVWILCEAHCLKVAVDGQHVFEYYHRLRNLPTINKLEVGGDIQL 351

Query: 123 KCV 125
             V
Sbjct: 352 THV 354


>dbj|BAF82952.1| unnamed protein product [Homo sapiens]
          Length = 356

 Score =  141 bits (356), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 30/127 (23%), Positives = 58/127 (45%), Gaps = 12/127 (9%)

Query: 11  LKPGECLRVRGEVAADA-KSFLLNL-----GKDDNNLCNPRFNAHGDVNTIVCNSKDAGA 64
           L+ G  + V G V + +   F ++      G D     NPRF    D   +VCN++  G 
Sbjct: 25  LQDGFQITVNGAVLSSSGTRFAVDFQTGFSGNDIAFHFNPRFE---DGGYVVCNTRQKGR 81

Query: 65  WGAEQRESAFPFQPGSVVE---VFNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFK 121
           WG E+R+   PFQ G   +   +   +D  + +      ++ +R+    ++ +S  G  +
Sbjct: 82  WGPEERKMHMPFQKGMPFDLCFLVQSSDFKVMVNGSLFVQYFHRVPFHRVDTISVNGSVQ 141

Query: 122 IKCVAFE 128
           +  ++F+
Sbjct: 142 LSYISFQ 148



 Score =  120 bits (303), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 37/123 (30%), Positives = 57/123 (46%), Gaps = 12/123 (9%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAE 68
           L P + + + G V   A+ F +NL  G       NPRF    D N +V N++   +WG+E
Sbjct: 236 LYPSKSIILSGTVLPSAQRFHINLCSGSHIAFHMNPRF----DENAVVRNTQINNSWGSE 291

Query: 69  QRE--SAFPFQPGSVV---EVFNQTDLTIKLPDGYEFKFPNRL-NLEAINYLSAGGDFKI 122
           +R      PF  G       +     L + +   + F++ +RL NL  IN L  GGD ++
Sbjct: 292 ERSLPRKMPFVRGQSFSVWILCEAHCLKVAVDGQHVFEYYHRLRNLPTINKLEVGGDIQL 351

Query: 123 KCV 125
             V
Sbjct: 352 THV 354


>sp|Q3B8N2|LEG9B_HUMAN RecName: Full=Galectin-9B; AltName: Full=Galectin-9-like protein A
          Length = 356

 Score =  141 bits (356), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 30/127 (23%), Positives = 58/127 (45%), Gaps = 12/127 (9%)

Query: 11  LKPGECLRVRGEVAADA-KSFLLNL-----GKDDNNLCNPRFNAHGDVNTIVCNSKDAGA 64
           L+ G  + V G V + +   F ++      G D     NPRF    D   +VCN++  G 
Sbjct: 25  LQDGFQITVNGAVLSSSGTRFAVDFQTGFSGNDIAFHFNPRFE---DGGYVVCNTRQKGR 81

Query: 65  WGAEQRESAFPFQPGSVVE---VFNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFK 121
           WG E+R+   PFQ G   +   +   +D  + +      ++ +R+    ++ +S  G  +
Sbjct: 82  WGPEERKMHMPFQKGMPFDLCFLVQSSDFKVMVNGSLFVQYFHRVPFHRVDTISVNGSVQ 141

Query: 122 IKCVAFE 128
           +  ++F+
Sbjct: 142 LSYISFQ 148



 Score =  120 bits (303), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 37/123 (30%), Positives = 57/123 (46%), Gaps = 12/123 (9%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAE 68
           L P + + + G V   A+ F +NL  G       NPRF    D N +V N++   +WG+E
Sbjct: 236 LYPSKSIILSGTVLPSAQRFHINLCSGSHIAFHMNPRF----DENAVVRNTQINNSWGSE 291

Query: 69  QRE--SAFPFQPGSVV---EVFNQTDLTIKLPDGYEFKFPNRL-NLEAINYLSAGGDFKI 122
           +R      PF  G       +     L + +   + F++ +RL NL  IN L  GGD ++
Sbjct: 292 ERSLPRKMPFVRGQSFSVWILCEAHCLKVAVDGQHVFEYYHRLRNLPTINKLEVGGDIQL 351

Query: 123 KCV 125
             V
Sbjct: 352 THV 354


>ref|NP_001036150.1| galectin-9 like [Homo sapiens]
          Length = 355

 Score =  141 bits (356), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 30/127 (23%), Positives = 58/127 (45%), Gaps = 12/127 (9%)

Query: 11  LKPGECLRVRGEVAADA-KSFLLNL-----GKDDNNLCNPRFNAHGDVNTIVCNSKDAGA 64
           L+ G  + V G V + +   F ++      G D     NPRF    D   +VCN++  G 
Sbjct: 25  LQDGFQITVNGAVLSSSGTRFAVDFQTGFSGNDIAFHFNPRFE---DGGYVVCNTRQKGR 81

Query: 65  WGAEQRESAFPFQPGSVVE---VFNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFK 121
           WG E+R+   PFQ G   +   +   +D  + +      ++ +R+    ++ +S  G  +
Sbjct: 82  WGPEERKMHMPFQKGMPFDLCFLVQSSDFKVMVNGSLFVQYFHRVPFHRVDTISVNGSVQ 141

Query: 122 IKCVAFE 128
           +  ++F+
Sbjct: 142 LSYISFQ 148



 Score =  120 bits (303), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 37/123 (30%), Positives = 57/123 (46%), Gaps = 12/123 (9%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAE 68
           L P + + + G V   A+ F +NL  G       NPRF    D N +V N++   +WG+E
Sbjct: 235 LYPSKSIILSGTVLPSAQRFHINLCSGSHIAFHMNPRF----DENAVVRNTQINNSWGSE 290

Query: 69  QRE--SAFPFQPGSVV---EVFNQTDLTIKLPDGYEFKFPNRL-NLEAINYLSAGGDFKI 122
           +R      PF  G       +     L + +   + F++ +RL NL  IN L  GGD ++
Sbjct: 291 ERSLPRKMPFVRGQSFSVWILCEAHCLKVAVDGQHVFEYYHRLRNLPTINKLEVGGDIQL 350

Query: 123 KCV 125
             V
Sbjct: 351 THV 353


>pdb|1HLC|A Chain A, X-Ray Crystal Structure Of The Human Dimeric S-Lac Lectin,
           L-14-Ii, In Complex With Lactose At 2.9 Angstroms
           Resolution
 pdb|1HLC|B Chain B, X-Ray Crystal Structure Of The Human Dimeric S-Lac Lectin,
           L-14-Ii, In Complex With Lactose At 2.9 Angstroms
           Resolution
          Length = 129

 Score =  141 bits (356), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 51/128 (39%), Positives = 69/128 (53%), Gaps = 4/128 (3%)

Query: 4   LVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNLCNPRFNAHGDVNTIVCNSKDAG 63
           L   N+++KPG  L++ G +A     F++NLG+  + L N  FN     +TIVCNS D  
Sbjct: 2   LEVKNMDMKPGSTLKITGSIADGTDGFVINLGQGTDKL-NLHFNPRFSESTIVCNSLDGS 60

Query: 64  AWGAEQRESAFPFQPGSVVE---VFNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDF 120
            WG EQRE    F PGS V+    F      +KLPDG+E  FPNRL    ++YLS  G F
Sbjct: 61  NWGQEQREDHLCFSPGSEVKFTVTFESDKFKVKLPDGHELTFPNRLGHSHLSYLSVRGGF 120

Query: 121 KIKCVAFE 128
            +     +
Sbjct: 121 NMSSFKLK 128


>gb|AAH29063.2| LGALS2 protein [Homo sapiens]
          Length = 130

 Score =  141 bits (356), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 51/128 (39%), Positives = 69/128 (53%), Gaps = 4/128 (3%)

Query: 4   LVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNLCNPRFNAHGDVNTIVCNSKDAG 63
           L   N+++KPG  L++ G +A     F++NLG+  + L N  FN     +TIVCNS D  
Sbjct: 3   LEVKNMDMKPGSTLKITGSIADGTDGFVINLGQGTDKL-NLHFNPRFSESTIVCNSLDGS 61

Query: 64  AWGAEQRESAFPFQPGSVVE---VFNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDF 120
            WG EQRE    F PGS V+    F      +KLPDG+E  FPNRL    ++YLS  G F
Sbjct: 62  NWGQEQREDHLCFSPGSEVKFTVTFESDKFKVKLPDGHELTFPNRLGHSHLSYLSVRGGF 121

Query: 121 KIKCVAFE 128
            +     +
Sbjct: 122 NMSSFKLK 129


>ref|XP_001156813.1| PREDICTED: hypothetical protein isoform 3 [Pan troglodytes]
          Length = 323

 Score =  141 bits (356), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 30/127 (23%), Positives = 58/127 (45%), Gaps = 12/127 (9%)

Query: 11  LKPGECLRVRGEVAADA-KSFLLNL-----GKDDNNLCNPRFNAHGDVNTIVCNSKDAGA 64
           L+ G  + V G V + +   F ++      G D     NPRF    D   +VCN++  G 
Sbjct: 25  LQDGFQITVNGAVLSSSGTRFAVDFQTGFSGNDIAFHFNPRFE---DGGYVVCNTRQKGR 81

Query: 65  WGAEQRESAFPFQPGSVVE---VFNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFK 121
           WG E+R+   PFQ G   +   +   +D  + +      ++ +R+    ++ +S  G  +
Sbjct: 82  WGPEERKMHMPFQKGMPFDLCFLVQSSDFKVMVNGSLFVQYFHRVPFHRVDTISVNGSVQ 141

Query: 122 IKCVAFE 128
           +  ++F+
Sbjct: 142 LSYISFQ 148



 Score =  120 bits (302), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 37/123 (30%), Positives = 57/123 (46%), Gaps = 12/123 (9%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAE 68
           L P + + + G V   A+ F +NL  G       NPRF    D N +V N++   +WG+E
Sbjct: 203 LYPSKSIILSGTVLPSAQRFHINLCSGSHIAFHMNPRF----DENAVVRNTQINNSWGSE 258

Query: 69  QRE--SAFPFQPGSVV---EVFNQTDLTIKLPDGYEFKFPNRL-NLEAINYLSAGGDFKI 122
           +R      PF  G       +     L + +   + F++ +RL NL  IN L  GGD ++
Sbjct: 259 ERSLPRKMPFVRGQSFSVWILCEAHCLKVAVDGQHVFEYYHRLRNLPTINKLEVGGDIQL 318

Query: 123 KCV 125
             V
Sbjct: 319 THV 321


>emb|CAA88922.1| galectin [Homo sapiens]
          Length = 323

 Score =  140 bits (355), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 30/127 (23%), Positives = 58/127 (45%), Gaps = 12/127 (9%)

Query: 11  LKPGECLRVRGEVAADA-KSFLLNL-----GKDDNNLCNPRFNAHGDVNTIVCNSKDAGA 64
           L+ G  + V G V + +   F +N      G D     NPRF    D   +VCN++  G+
Sbjct: 25  LQDGLQITVNGTVLSSSGTRFAVNFQTGFSGNDIAFHFNPRFE---DGGYVVCNTRQNGS 81

Query: 65  WGAEQRESAFPFQPGSVVE---VFNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFK 121
           WG E+R +  PFQ G   +   +   +D  + +      ++ +R+    ++ +   G  +
Sbjct: 82  WGPEERRTHMPFQKGMPFDLCFLVQSSDFKVMVNGILFVQYFHRVPFHRVDTIFVNGSVQ 141

Query: 122 IKCVAFE 128
           +  ++F+
Sbjct: 142 LSYISFQ 148



 Score =  116 bits (292), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 37/123 (30%), Positives = 57/123 (46%), Gaps = 12/123 (9%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAE 68
           L P + + + G V   A+ F +NL  G       N RF    D N +V N++   +WG+E
Sbjct: 203 LYPSKSILLSGTVLPSAQRFHINLCSGNHIAFHLNLRF----DENAVVRNTQIDNSWGSE 258

Query: 69  QRE--SAFPFQPGSVVEVFN---QTDLTIKLPDGYEFKFPNRL-NLEAINYLSAGGDFKI 122
           +R      PF  G    V+       L + +   + F++ +RL NL  IN L  GGD ++
Sbjct: 259 ERSLPRKMPFVRGQSFSVWILCGAHCLKVAVDGQHLFEYYHRLRNLPTINRLEVGGDIQL 318

Query: 123 KCV 125
             V
Sbjct: 319 THV 321


>ref|NP_001035167.2| galectin 9 like [Homo sapiens]
          Length = 356

 Score =  140 bits (355), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 30/127 (23%), Positives = 57/127 (44%), Gaps = 12/127 (9%)

Query: 11  LKPGECLRVRGEVAA-DAKSFLLNL-----GKDDNNLCNPRFNAHGDVNTIVCNSKDAGA 64
           L+ G  + V G V +     F ++      G D     NPRF    D   +VCN++  G 
Sbjct: 25  LQDGFQITVNGAVLSCSGTRFAVDFQTGFSGNDIAFHFNPRFE---DGGYVVCNTRQKGT 81

Query: 65  WGAEQRESAFPFQPGSVVE---VFNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFK 121
           WG E+R+   PFQ G   +   +   +D  + +      ++ +R+    ++ +S  G  +
Sbjct: 82  WGPEERKMHMPFQKGMPFDLCFLVQSSDFKVMVNGSLFVQYFHRVPFHRVDTISVNGSVQ 141

Query: 122 IKCVAFE 128
           +  ++F+
Sbjct: 142 LSYISFQ 148



 Score =  120 bits (303), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 37/123 (30%), Positives = 57/123 (46%), Gaps = 12/123 (9%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAE 68
           L P + + + G V   A+ F +NL  G       NPRF    D N +V N++   +WG+E
Sbjct: 236 LYPSKSIILSGTVLPSAQRFHINLCSGSHIAFHMNPRF----DENAVVRNTQINNSWGSE 291

Query: 69  QRE--SAFPFQPGSVV---EVFNQTDLTIKLPDGYEFKFPNRL-NLEAINYLSAGGDFKI 122
           +R      PF  G       +     L + +   + F++ +RL NL  IN L  GGD ++
Sbjct: 292 ERSLPRKMPFVRGQSFSVWILCEAHCLKVAVDGQHVFEYYHRLRNLPTINKLEVGGDIQL 351

Query: 123 KCV 125
             V
Sbjct: 352 THV 354


>sp|Q6DKI2|LEG9C_HUMAN RecName: Full=Galectin-9C; AltName: Full=Galectin-9-like protein B
 gb|AAH73889.1| Lectin, galactoside-binding, soluble, 9C [Homo sapiens]
          Length = 356

 Score =  140 bits (355), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 30/127 (23%), Positives = 57/127 (44%), Gaps = 12/127 (9%)

Query: 11  LKPGECLRVRGEVAA-DAKSFLLNL-----GKDDNNLCNPRFNAHGDVNTIVCNSKDAGA 64
           L+ G  + V G V +     F ++      G D     NPRF    D   +VCN++  G 
Sbjct: 25  LQDGFQITVNGAVLSCSGTRFAVDFQTGFSGNDIAFHFNPRFE---DGGYVVCNTRQKGT 81

Query: 65  WGAEQRESAFPFQPGSVVE---VFNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFK 121
           WG E+R+   PFQ G   +   +   +D  + +      ++ +R+    ++ +S  G  +
Sbjct: 82  WGPEERKMHMPFQKGMPFDLCFLVQSSDFKVMVNGSLFVQYFHRVPFHRVDTISVNGSVQ 141

Query: 122 IKCVAFE 128
           +  ++F+
Sbjct: 142 LSYISFQ 148



 Score =  120 bits (303), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 37/123 (30%), Positives = 57/123 (46%), Gaps = 12/123 (9%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAE 68
           L P + + + G V   A+ F +NL  G       NPRF    D N +V N++   +WG+E
Sbjct: 236 LYPSKSIILSGTVLPSAQRFHINLCSGSHIAFHMNPRF----DENAVVRNTQINNSWGSE 291

Query: 69  QRE--SAFPFQPGSVV---EVFNQTDLTIKLPDGYEFKFPNRL-NLEAINYLSAGGDFKI 122
           +R      PF  G       +     L + +   + F++ +RL NL  IN L  GGD ++
Sbjct: 292 ERSLPRKMPFVRGQSFSVWILCEAHCLKVAVDGQHVFEYYHRLRNLPTINKLEVGGDIQL 351

Query: 123 KCV 125
             V
Sbjct: 352 THV 354


>ref|XP_001504125.1| PREDICTED: similar to galectin 9 short isoform 1 [Equus caballus]
          Length = 326

 Score =  140 bits (355), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 33/127 (25%), Positives = 57/127 (44%), Gaps = 12/127 (9%)

Query: 11  LKPGECLRVRGEVAA-DAKSFLLNLG-----KDDNNLCNPRFNAHGDVNTIVCNSKDAGA 64
           L+ G  + V G +   +   F +N        D     NPRF    +   +VCN+K  G 
Sbjct: 25  LQDGLQITVIGTILPFNGTRFAVNFQIGSSDNDIAFHFNPRFE---NGGYLVCNTKQNGC 81

Query: 65  WGAEQRESAFPFQPGSVVE---VFNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFK 121
           WG E+R+   PFQ GS  E   +   +   + L      ++P+R+    ++ LS  G  +
Sbjct: 82  WGREERKMHLPFQRGSPFELIFLVQSSHFQVMLNGSPFVQYPHRVPFHRVDTLSINGIVQ 141

Query: 122 IKCVAFE 128
           +  ++F+
Sbjct: 142 LFSISFQ 148



 Score =  116 bits (292), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 40/123 (32%), Positives = 56/123 (45%), Gaps = 12/123 (9%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAE 68
           L P + + V G V   A+ F +NL  G D     NPRF    D NT+V N+   G+WG E
Sbjct: 206 LYPSKRIFVSGTVLPSAQRFHINLRSGSDIAFHLNPRF----DENTVVRNTHVNGSWGHE 261

Query: 69  QRE--SAFPFQPGSVVEVFNQTD---LTIKLPDGYEFKFPNRL-NLEAINYLSAGGDFKI 122
           +R      PF  G    V    +   L + +   +   + +RL NL  IN L   GD ++
Sbjct: 262 ERSLCGKMPFTRGQSFSVCITCEGHCLRVVVDGQHLCDYNHRLKNLPGINNLEVAGDVQL 321

Query: 123 KCV 125
             V
Sbjct: 322 TRV 324


>ref|NP_001095811.1| galectin 3 [Bos taurus]
 gb|AAI48137.1| LGALS3 protein [Bos taurus]
          Length = 265

 Score =  140 bits (355), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 33/122 (27%), Positives = 55/122 (45%), Gaps = 7/122 (5%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAE 68
           ++P   + + G V  +A    L+   G D     NPRFN   +   IVCNSK    WG E
Sbjct: 141 IRPRMLITILGTVKPNANRLALDFKRGNDVAFHFNPRFNE-DNRRVIVCNSKLNNNWGKE 199

Query: 69  QRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRL-NLEAINYLSAGGDFKIKC 124
           +R+  FPF+ G   ++          + + D +  ++ +R+ N   I+ L   GD  +  
Sbjct: 200 ERQMVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKNFGEISTLGISGDITLTS 259

Query: 125 VA 126
            +
Sbjct: 260 AS 261


>ref|NP_999146.1| galectin-4 [Sus scrofa]
 sp|Q29058|LEG4_PIG RecName: Full=Galectin-4; AltName: Full=Lactose-binding lectin 4;
           AltName: Full=L-36 lactose-binding protein; Short=L36LBP
 emb|CAA55884.1| L-36 lactose binding protein [Sus scrofa]
          Length = 323

 Score =  140 bits (354), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 28/126 (22%), Positives = 56/126 (44%), Gaps = 12/126 (9%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL------GKDDNNLCNPRFNAHGDVNTIVCNSKDAGA 64
           L+ G  + ++G      K F +N       G D     NPRF+     + +V NS+  G 
Sbjct: 27  LRVGMSVYIQGVANEHMKRFFVNFVVGQGPGADVAFHFNPRFDGW---DKVVFNSQQDGK 83

Query: 65  WGAEQRESAFPFQPGSVVEVFNQ---TDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFK 121
           WG E+++ + PF+     E+          + +     ++F +R+ ++ + +L   GD  
Sbjct: 84  WGNEEKKRSMPFRKAPAFELVIMVLPEHYKVVVNGDPFYEFGHRIPVQLVTHLQVDGDLT 143

Query: 122 IKCVAF 127
           ++ + F
Sbjct: 144 LQSINF 149



 Score =  106 bits (266), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 31/120 (25%), Positives = 51/120 (42%), Gaps = 5/120 (4%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNLGKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAEQR 70
           L     + ++G V    KS ++N     +       N       +V NS   G WGAE+R
Sbjct: 202 LVARRTIVIKGYVPPSGKSLVINFKVGSSGDVALHINPRLTEGIVVRNSYLNGKWGAEER 261

Query: 71  ESAF-PFQPGSVVEVFNQTD---LTIKLPDGYEFKFPNRL-NLEAINYLSAGGDFKIKCV 125
           +S+F PF PG   ++  +       +     + F F +RL N + ++ L   GD  +  V
Sbjct: 262 KSSFNPFAPGQYFDLSIRCGLDRFKVYANGQHLFDFSHRLSNFQGVDTLEIQGDVTLSYV 321


>ref|NP_034837.1| lectin, galactose binding, soluble 6 [Mus musculus]
 sp|O54891|LEG6_MOUSE RecName: Full=Galectin-6
 gb|AAC04508.1| galectin-6 [Mus musculus]
 gb|AAI60275.1| Lectin, galactose binding, soluble 6 [synthetic construct]
          Length = 301

 Score =  140 bits (354), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 30/126 (23%), Positives = 57/126 (45%), Gaps = 13/126 (10%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL------GKDDNNLCNPRFNAHGDVNTIVCNSKDAGA 64
           L  G    ++G    + + F +N       G D     NPRF+     + +V N+K +G 
Sbjct: 27  LSVGMSFYIQGTAKENMRRFHVNFAVGQDDGADVAFHFNPRFDGW---DKVVFNTKQSGR 83

Query: 65  WGAEQRESAFPFQPGSVVEVFNQ---TDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFK 121
           WG E+ E + PFQ G   E+          + +     +++ +RL ++ + +L   GD +
Sbjct: 84  WGKEE-EKSMPFQKGKHFELVFMVMPEHYKVVVNGSPFYEYGHRLPVQMVTHLQVDGDLE 142

Query: 122 IKCVAF 127
           ++ + F
Sbjct: 143 LQSINF 148



 Score = 95.8 bits (238), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 32/124 (25%), Positives = 50/124 (40%), Gaps = 14/124 (11%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL----GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWG 66
                 + ++G V   AK+F +N      +D     NPR       + +V NS   G+WG
Sbjct: 181 FTVRRTIIIKGYVLPTAKTFAINFRVGSSEDIALHINPRI-----GDCLVRNSYMNGSWG 235

Query: 67  AEQRE-SAFPFQPGSVVEVFNQTD---LTIKLPDGYEFKFPNRL-NLEAINYLSAGGDFK 121
            E+R  +  PF PG   ++  +       +     + F F +R   L  IN L   GD  
Sbjct: 236 TEERMVAYNPFGPGQFFDLSIRCGMDRFKVFANGIHLFNFSHRFQALRKINTLEINGDLT 295

Query: 122 IKCV 125
           +  V
Sbjct: 296 LSYV 299


>ref|XP_525588.2| PREDICTED: lectin, galactoside-binding, soluble, 2 [Pan
           troglodytes]
          Length = 132

 Score =  140 bits (354), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 50/128 (39%), Positives = 68/128 (53%), Gaps = 4/128 (3%)

Query: 4   LVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNLCNPRFNAHGDVNTIVCNSKDAG 63
           L   N+++KPG  L++ G +A     F++NLG+  + L N  FN     + IVCNS D  
Sbjct: 5   LEVKNMDMKPGSTLKITGSIADGTDGFVINLGQGTDKL-NLHFNPRFSESIIVCNSLDGS 63

Query: 64  AWGAEQRESAFPFQPGSVVE---VFNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDF 120
            WG EQRE    F PGS V+    F      +KLPDG+E  FPNRL    ++YLS  G F
Sbjct: 64  NWGQEQREDHLCFSPGSEVKFTVTFESDKFKVKLPDGHELTFPNRLGHSHLSYLSIRGGF 123

Query: 121 KIKCVAFE 128
            +     +
Sbjct: 124 NMSSFKLK 131


>dbj|BAD96952.1| galectin 9 short isoform variant [Homo sapiens]
          Length = 323

 Score =  140 bits (353), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 30/127 (23%), Positives = 59/127 (46%), Gaps = 12/127 (9%)

Query: 11  LKPGECLRVRGEVAADA-KSFLLNL-----GKDDNNLCNPRFNAHGDVNTIVCNSKDAGA 64
           L+ G  + V G V + +   F +N      G D     NPRF    D   +VCN++  G+
Sbjct: 25  LQDGLQITVNGTVLSSSGTRFAVNFQTGFSGNDIAFHFNPRFE---DGGYVVCNTRQNGS 81

Query: 65  WGAEQRESAFPFQPGSVVE---VFNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFK 121
           WG E+R++  P Q G   +   +   +D  + +      ++ +R+    ++ +S  G  +
Sbjct: 82  WGPEERKTHMPSQKGMPFDLCFLVQSSDFKVMVNGILFVQYFHRVPFHRVDTISVNGSVQ 141

Query: 122 IKCVAFE 128
           +  ++F+
Sbjct: 142 LSYISFQ 148



 Score =  120 bits (303), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 37/123 (30%), Positives = 57/123 (46%), Gaps = 12/123 (9%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAE 68
           L P + + + G V   A+ F +NL  G       NPRF    D N +V N++   +WG+E
Sbjct: 203 LYPSKSILLSGTVLPSAQRFHINLCSGNHIAFHLNPRF----DENAVVRNTQIDNSWGSE 258

Query: 69  QRE--SAFPFQPGSVV---EVFNQTDLTIKLPDGYEFKFPNRL-NLEAINYLSAGGDFKI 122
           +R      PF  G       +     L + +   + F++ +RL NL  IN L  GGD ++
Sbjct: 259 ERSLPRKMPFVRGQSFSVWILCEAHCLKVAVDGQHLFEYYHRLRNLPTINRLEVGGDIQL 318

Query: 123 KCV 125
             V
Sbjct: 319 THV 321


>gb|ACO08221.1| Galectin-9 [Oncorhynchus mykiss]
          Length = 341

 Score =  140 bits (353), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 35/127 (27%), Positives = 60/127 (47%), Gaps = 11/127 (8%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL------GKDDNNLCNPRFNAHGDVNTIVCNSKDAGA 64
           L+ G+ + + G V   A  F +NL      G D     NPR+++H     +V N+     
Sbjct: 24  LQEGKTITITGRVHHGADRFRVNLQCGSRAGADIALHFNPRYDSHP--GYVVTNTLQQSK 81

Query: 65  WGAEQRESAFPFQPGSVV--EVFNQTDLTI-KLPDGYEFKFPNRLNLEAINYLSAGGDFK 121
           WG E+R+   PFQ GS    E+  Q D    K+   +   F +R+   +++ +SA G  +
Sbjct: 82  WGTEERKQHSPFQRGSSFSLEITVQRDFFQLKVNGNHFMTFKHRIPFYSVDTISADGKVE 141

Query: 122 IKCVAFE 128
           +  + F+
Sbjct: 142 LTSIVFQ 148



 Score =  123 bits (310), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 34/124 (27%), Positives = 49/124 (39%), Gaps = 10/124 (8%)

Query: 8   NLNLKPGECLRVRGEVAADAKSFLLNLG--KDDNNLCNPRFNAHGDVNTIVCNSKDAGAW 65
           N  L PG  + ++G V  +A  F +NL          NPRF+       +V NSK    W
Sbjct: 220 NGGLYPGRTINIQGVVNPNANRFHINLLFNSGIALHFNPRFDETL----VVRNSKLRDQW 275

Query: 66  GAEQRESAFPFQPGSVVEVFNQTD---LTIKLPDGYEFKFPNRLN-LEAINYLSAGGDFK 121
           G E+R    PF  G    +    D     I +       + +R   L+ +N L   GD  
Sbjct: 276 GKEERSGGMPFHRGQAFTLSITCDAQCYKIVVNGNQTSTYKHRHTLLQQVNILEVDGDLS 335

Query: 122 IKCV 125
           +  V
Sbjct: 336 LTSV 339


>gb|AAC27244.1| galectin-6 [Mus musculus]
          Length = 301

 Score =  140 bits (353), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 30/126 (23%), Positives = 57/126 (45%), Gaps = 13/126 (10%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL------GKDDNNLCNPRFNAHGDVNTIVCNSKDAGA 64
           L  G    ++G    + + F +N       G D     NPRF+     + +V N+K +G 
Sbjct: 27  LSVGMSFYIQGTAKENMRRFHVNFAVGQDDGADVAFHFNPRFDGW---DKVVFNTKQSGR 83

Query: 65  WGAEQRESAFPFQPGSVVEVFNQ---TDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFK 121
           WG E+ E + PFQ G   E+          + +     +++ +RL ++ + +L   GD +
Sbjct: 84  WGKEE-EKSMPFQKGKHFELVFMVMPEHYKVVVNGSPFYEYGHRLPVQMVTHLQVDGDLE 142

Query: 122 IKCVAF 127
           ++ + F
Sbjct: 143 LQSINF 148



 Score = 95.8 bits (238), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 32/124 (25%), Positives = 50/124 (40%), Gaps = 14/124 (11%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL----GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWG 66
                 + ++G V   AK+F +N      +D     NPR       + +V NS   G+WG
Sbjct: 181 FTVRRTIIIKGYVLPTAKTFAINFRVGSSEDIALHINPRI-----GDCLVRNSYMNGSWG 235

Query: 67  AEQRE-SAFPFQPGSVVEVFNQTD---LTIKLPDGYEFKFPNRL-NLEAINYLSAGGDFK 121
            E+R  +  PF PG   ++  +       +     + F F +R   L  IN L   GD  
Sbjct: 236 TEERMVAYNPFGPGQFFDLSIRCGMDRFKVFANGIHLFNFSHRFQALRKINTLEINGDLT 295

Query: 122 IKCV 125
           +  V
Sbjct: 296 LSYV 299


>ref|NP_079898.1| lectin, galactose-binding, soluble 2 [Mus musculus]
 dbj|BAB25806.1| unnamed protein product [Mus musculus]
          Length = 130

 Score =  140 bits (353), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 52/126 (41%), Positives = 73/126 (57%), Gaps = 5/126 (3%)

Query: 6   ASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNLCNPRFNAHGDVNTIVCNSKDAGAW 65
             +LN+KPG  L+++G++  D   FL+NL +    L N  FN   D +TIVCN+ + G W
Sbjct: 7   VKDLNMKPGMSLKIKGKIHNDVDRFLINLVQGKETL-NLHFNPRFDESTIVCNTSEGGRW 65

Query: 66  GAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFKI 122
           G EQRE+   F PGS V++   F   D  + LPDG++  FPNRL    ++YLS GG  +I
Sbjct: 66  GQEQRENHMCFSPGSEVKITITFQDKDFKVTLPDGHQLTFPNRLGHNQLHYLSMGG-LQI 124

Query: 123 KCVAFE 128
                E
Sbjct: 125 SSFKLE 130


>gb|EDL15598.1| lectin, galactose binding, soluble 9, isoform CRA_b [Mus musculus]
          Length = 231

 Score =  140 bits (353), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 31/126 (24%), Positives = 61/126 (48%), Gaps = 11/126 (8%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL-----GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAW 65
           L+ G  + ++G   + A+ F++N      G D     NPRF   G    +VCN+K  G W
Sbjct: 25  LQEGLQVTLQGTTKSFAQRFVVNFQNSFNGNDIAFHFNPRFEEGG---YVVCNTKQNGQW 81

Query: 66  GAEQRESAFPFQPGSVVE---VFNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFKI 122
           G E+R+   PFQ G   E   +  +++  + +   +  ++ +R+    ++ ++  G  K+
Sbjct: 82  GPEERKMQMPFQKGMPFELCFLVQRSEFKVMVNKKFFVQYQHRVPYHLVDTIAVSGCLKL 141

Query: 123 KCVAFE 128
             + F+
Sbjct: 142 SFITFQ 147



 Score = 35.4 bits (81), Expect = 1.6,   Method: Composition-based stats.
 Identities = 9/24 (37%), Positives = 13/24 (54%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL 34
           L P + + + G V  DA  F +NL
Sbjct: 202 LYPSKSIMISGNVLPDATRFHINL 225


>sp|P56217|LEG1_BUFAR RecName: Full=Galectin-1
 pdb|1A78|A Chain A, Complex Of Toad Ovary Galectin With Thio-Digalactose
 pdb|1A78|B Chain B, Complex Of Toad Ovary Galectin With Thio-Digalactose
          Length = 134

 Score =  139 bits (352), Expect = 6e-32,   Method: Composition-based stats.
 Identities = 59/124 (47%), Positives = 78/124 (62%), Gaps = 6/124 (4%)

Query: 1   ACGLVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNN---LCNPRFNAHGDVNTIVC 57
           + G+  +NLNLKPG C+ ++G +  D K F +NLG+D +N     N RF+ HGDVN IVC
Sbjct: 2   SAGVAVTNLNLKPGHCVEIKGSIPPDCKGFAVNLGEDASNFLLHFNARFDLHGDVNKIVC 61

Query: 58  NSKDAGAWGAEQRESAFPFQPGSVVEVFNQ---TDLTIKLPDGYEFKFPNRLNLEAINYL 114
           NSK+A AWG+EQRE  FPFQ G+ V V  +     + IK   G +F FP R  L +I +L
Sbjct: 62  NSKEADAWGSEQREEVFPFQQGAEVMVCFEYQTQKIIIKFSSGDQFSFPVRKVLPSIPFL 121

Query: 115 SAGG 118
           S  G
Sbjct: 122 SLEG 125


>gb|ACI67584.1| Galectin-9 [Salmo salar]
          Length = 344

 Score =  139 bits (352), Expect = 6e-32,   Method: Composition-based stats.
 Identities = 36/127 (28%), Positives = 62/127 (48%), Gaps = 11/127 (8%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL------GKDDNNLCNPRFNAHGDVNTIVCNSKDAGA 64
           L+ G+ + + G V   A  F +NL      G D     NPR+++H     +V N+     
Sbjct: 24  LQEGKTIIITGRVPHGADRFHVNLQCGSMAGADIALHFNPRYDSHP--GYVVTNTLQQSK 81

Query: 65  WGAEQRESAFPFQPGSVV--EVFNQTDLTI-KLPDGYEFKFPNRLNLEAINYLSAGGDFK 121
           WG+E+R+   PFQ GS    E+  Q D     +   +   F +R+   +++ +SAGG  +
Sbjct: 82  WGSEERKQHSPFQHGSSFSLEITVQRDFFKLNVNGNHFMTFKHRIPFYSVDTISAGGKVE 141

Query: 122 IKCVAFE 128
           +  +AF+
Sbjct: 142 LTSIAFQ 148



 Score =  125 bits (314), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 33/124 (26%), Positives = 47/124 (37%), Gaps = 10/124 (8%)

Query: 8   NLNLKPGECLRVRGEVAADAKSFLLNLG--KDDNNLCNPRFNAHGDVNTIVCNSKDAGAW 65
           N  L PG  + ++G V  +A  F +NL          NPRF+       +V NSK    W
Sbjct: 223 NGGLYPGRTINIQGVVKPNANRFHVNLLFNSGIALHFNPRFDETL----VVRNSKLRDQW 278

Query: 66  GAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRL-NLEAINYLSAGGDFK 121
           G E+R    PF  G    +          I +       + +R   L  +N L   GD  
Sbjct: 279 GKEERSGGMPFHRGQSFTLSIFCEDQCFKIAVNGNQTTTYKHRHTPLNQVNILEVDGDLS 338

Query: 122 IKCV 125
           +  V
Sbjct: 339 LTSV 342


>gb|AAA36171.1| beta-galactoside-binding lectin
          Length = 127

 Score =  139 bits (352), Expect = 7e-32,   Method: Composition-based stats.
 Identities = 50/126 (39%), Positives = 68/126 (53%), Gaps = 4/126 (3%)

Query: 6   ASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNLCNPRFNAHGDVNTIVCNSKDAGAW 65
             N+++KPG  L++ G +A     F++NLG+  + L N  FN     +TIVCNS D   W
Sbjct: 2   VKNMDMKPGSTLKITGSIADGTDGFVINLGQGTDKL-NLHFNPRFSESTIVCNSLDGSNW 60

Query: 66  GAEQRESAFPFQPGSVVE---VFNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFKI 122
           G EQRE    F PGS V+    F      +KLPDG+E  FPNRL    ++YLS  G F +
Sbjct: 61  GQEQREDHLCFSPGSEVKFTVTFESDKFKVKLPDGHELTFPNRLGHSHLSYLSIRGGFNM 120

Query: 123 KCVAFE 128
                +
Sbjct: 121 SSFKLK 126


>ref|NP_001003345.1| galectin-9 [Canis lupus familiaris]
 gb|AAS80311.1| galectin 9 [Canis familiaris]
          Length = 323

 Score =  139 bits (352), Expect = 7e-32,   Method: Composition-based stats.
 Identities = 32/127 (25%), Positives = 60/127 (47%), Gaps = 12/127 (9%)

Query: 11  LKPGECLRVRGEVAA-DAKSFLLNLGK-----DDNNLCNPRFNAHGDVNTIVCNSKDAGA 64
           L+ G  + + G +   +   F +N        D     NPRF   G    +VCN+K  G+
Sbjct: 25  LQDGLKITINGTILYCNGTRFAVNFHSGHSDSDIAFHFNPRFEEGG---YVVCNTKQKGS 81

Query: 65  WGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFK 121
           WG+E+R+   PFQ G+  E+    N  D  + +   +  ++ +R+    ++ LS  G  +
Sbjct: 82  WGSEERKMQMPFQMGNPFELCFMVNSCDFKVTVNGSHFTQYSHRVPFHYVDTLSITGAVQ 141

Query: 122 IKCVAFE 128
           +  ++F+
Sbjct: 142 LSYISFQ 148



 Score =  120 bits (303), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 40/123 (32%), Positives = 59/123 (47%), Gaps = 12/123 (9%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAE 68
           L P + + V G V   AK F +NL  G D     NPRFN     NT+V N +   +WG+E
Sbjct: 203 LYPSKSIIVSGTVLPGAKRFHINLRSGNDIAFHLNPRFN----ENTVVRNMQINNSWGSE 258

Query: 69  QRE--SAFPFQPGSVVEVFNQTD---LTIKLPDGYEFKFPNRL-NLEAINYLSAGGDFKI 122
           +R      PF  G    V+   +     + +   + F++ +RL NL AIN +   GD ++
Sbjct: 259 ERSLPRKMPFVQGQSFSVWIMCEGHCFKVAVDGEHLFEYYHRLKNLLAINNMEVAGDVQL 318

Query: 123 KCV 125
             V
Sbjct: 319 THV 321


>gb|AAH03754.1| Lgals9 protein [Mus musculus]
          Length = 322

 Score =  139 bits (352), Expect = 7e-32,   Method: Composition-based stats.
 Identities = 31/126 (24%), Positives = 61/126 (48%), Gaps = 11/126 (8%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL-----GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAW 65
           L+ G  + ++G   + A+ F++N      G D     NPRF   G    +VCN+K  G W
Sbjct: 25  LQEGLQVTLQGTTKSFAQRFVVNFQNSFNGNDIAFHFNPRFEEGG---YVVCNTKQNGQW 81

Query: 66  GAEQRESAFPFQPGSVVE---VFNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFKI 122
           G E+R+   PFQ G   E   +  +++  + +   +  ++ +R+    ++ ++  G  K+
Sbjct: 82  GPEERKMQMPFQKGMPFELCFLVQRSEFKVMVNKKFFVQYQHRVPYHLVDTIAVSGCLKL 141

Query: 123 KCVAFE 128
             + F+
Sbjct: 142 SFITFQ 147



 Score =  126 bits (318), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 36/123 (29%), Positives = 55/123 (44%), Gaps = 12/123 (9%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAE 68
           L P + + + G V  DA  F +NL  G D     NPRFN     N +V N++   +WG E
Sbjct: 202 LYPSKSIMISGNVLPDATRFHINLRCGGDIAFHLNPRFN----ENAVVRNTQINNSWGQE 257

Query: 69  QRE--SAFPFQPGSVV---EVFNQTDLTIKLPDGYEFKFPNRL-NLEAINYLSAGGDFKI 122
           +R      PF  G       +       + +   +  ++ +RL NL+ IN L   GD ++
Sbjct: 258 ERSLLGRMPFSRGQSFSVWIICEGHCFKVAVNGQHMCEYYHRLKNLQDINTLEVAGDIQL 317

Query: 123 KCV 125
             V
Sbjct: 318 THV 320


>emb|CAI24051.1| lectin, galactose binding, soluble 9 [Mus musculus]
 emb|CAI25277.1| lectin, galactose binding, soluble 9 [Mus musculus]
          Length = 352

 Score =  139 bits (352), Expect = 7e-32,   Method: Composition-based stats.
 Identities = 31/126 (24%), Positives = 61/126 (48%), Gaps = 11/126 (8%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL-----GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAW 65
           L+ G  + ++G   + A+ F++N      G D     NPRF   G    +VCN+K  G W
Sbjct: 25  LQEGLQVTLQGTTKSFAQRFVVNFQNSFNGNDIAFHFNPRFEEGG---YVVCNTKQNGQW 81

Query: 66  GAEQRESAFPFQPGSVVE---VFNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFKI 122
           G E+R+   PFQ G   E   +  +++  + +   +  ++ +R+    ++ ++  G  K+
Sbjct: 82  GPEERKMQMPFQKGMPFELCFLVQRSEFKVMVNKKFFVQYQHRVPYHLVDTIAVSGCLKL 141

Query: 123 KCVAFE 128
             + F+
Sbjct: 142 SFITFQ 147



 Score =  126 bits (318), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 36/123 (29%), Positives = 55/123 (44%), Gaps = 12/123 (9%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAE 68
           L P + + + G V  DA  F +NL  G D     NPRFN     N +V N++   +WG E
Sbjct: 232 LYPSKSIMISGNVLPDATRFHINLRCGGDIAFHLNPRFN----ENAVVRNTQINNSWGQE 287

Query: 69  QRE--SAFPFQPGSVV---EVFNQTDLTIKLPDGYEFKFPNRL-NLEAINYLSAGGDFKI 122
           +R      PF  G       +       + +   +  ++ +RL NL+ IN L   GD ++
Sbjct: 288 ERSLLGRMPFSRGQSFSVWIICEGHCFKVAVNGQHMCEYYHRLKNLQDINTLEVAGDIQL 347

Query: 123 KCV 125
             V
Sbjct: 348 THV 350


>sp|O08573|LEG9_MOUSE RecName: Full=Galectin-9
 gb|AAB51190.1| beta-galactoside binding lectin intestine isoform
          Length = 353

 Score =  139 bits (351), Expect = 7e-32,   Method: Composition-based stats.
 Identities = 31/126 (24%), Positives = 61/126 (48%), Gaps = 11/126 (8%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL-----GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAW 65
           L+ G  + ++G   + A+ F++N      G D     NPRF   G    +VCN+K  G W
Sbjct: 25  LQEGLQVTLQGTTKSFAQRFVVNFQNSFNGNDIAFHFNPRFEEGG---YVVCNTKQNGQW 81

Query: 66  GAEQRESAFPFQPGSVVE---VFNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFKI 122
           G E+R+   PFQ G   E   +  +++  + +   +  ++ +R+    ++ ++  G  K+
Sbjct: 82  GPEERKMQMPFQKGMPFELCFLVQRSEFKVMVNKKFFVQYQHRVPYHLVDTIAVSGCLKL 141

Query: 123 KCVAFE 128
             + F+
Sbjct: 142 SFITFQ 147



 Score =  126 bits (318), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 36/123 (29%), Positives = 55/123 (44%), Gaps = 12/123 (9%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAE 68
           L P + + + G V  DA  F +NL  G D     NPRFN     N +V N++   +WG E
Sbjct: 233 LYPSKSIMISGNVLPDATRFHINLRCGGDIAFHLNPRFN----ENAVVRNTQINNSWGQE 288

Query: 69  QRE--SAFPFQPGSVV---EVFNQTDLTIKLPDGYEFKFPNRL-NLEAINYLSAGGDFKI 122
           +R      PF  G       +       + +   +  ++ +RL NL+ IN L   GD ++
Sbjct: 289 ERSLLGRMPFSRGQSFSVWIICEGHCFKVAVNGQHMCEYYHRLKNLQDINTLEVAGDIQL 348

Query: 123 KCV 125
             V
Sbjct: 349 THV 351


>ref|NP_034838.2| lectin, galactose binding, soluble 9 isoform 1 [Mus musculus]
 gb|EDL15599.1| lectin, galactose binding, soluble 9, isoform CRA_c [Mus musculus]
          Length = 353

 Score =  139 bits (351), Expect = 8e-32,   Method: Composition-based stats.
 Identities = 31/126 (24%), Positives = 61/126 (48%), Gaps = 11/126 (8%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL-----GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAW 65
           L+ G  + ++G   + A+ F++N      G D     NPRF   G    +VCN+K  G W
Sbjct: 25  LQEGLQVTLQGTTKSFAQRFVVNFQNSFNGNDIAFHFNPRFEEGG---YVVCNTKQNGQW 81

Query: 66  GAEQRESAFPFQPGSVVE---VFNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFKI 122
           G E+R+   PFQ G   E   +  +++  + +   +  ++ +R+    ++ ++  G  K+
Sbjct: 82  GPEERKMQMPFQKGMPFELCFLVQRSEFKVMVNKKFFVQYQHRVPYHLVDTIAVSGCLKL 141

Query: 123 KCVAFE 128
             + F+
Sbjct: 142 SFITFQ 147



 Score =  126 bits (318), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 36/123 (29%), Positives = 55/123 (44%), Gaps = 12/123 (9%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAE 68
           L P + + + G V  DA  F +NL  G D     NPRFN     N +V N++   +WG E
Sbjct: 233 LYPSKSIMISGNVLPDATRFHINLRCGGDIAFHLNPRFN----ENAVVRNTQINNSWGQE 288

Query: 69  QRE--SAFPFQPGSVV---EVFNQTDLTIKLPDGYEFKFPNRL-NLEAINYLSAGGDFKI 122
           +R      PF  G       +       + +   +  ++ +RL NL+ IN L   GD ++
Sbjct: 289 ERSLLGRMPFSRGQSFSVWIICEGHCFKVAVNGQHMCEYYHRLKNLQDINTLEVAGDIQL 348

Query: 123 KCV 125
             V
Sbjct: 349 THV 351


>ref|NP_001152773.1| lectin, galactose binding, soluble 9 isoform 2 [Mus musculus]
 gb|AAB51189.1| beta-galactoside binding lectin
 emb|CAI24050.1| lectin, galactose binding, soluble 9 [Mus musculus]
 emb|CAI25276.1| lectin, galactose binding, soluble 9 [Mus musculus]
 dbj|BAE26856.1| unnamed protein product [Mus musculus]
 gb|EDL15600.1| lectin, galactose binding, soluble 9, isoform CRA_d [Mus musculus]
          Length = 322

 Score =  139 bits (351), Expect = 8e-32,   Method: Composition-based stats.
 Identities = 31/126 (24%), Positives = 61/126 (48%), Gaps = 11/126 (8%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL-----GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAW 65
           L+ G  + ++G   + A+ F++N      G D     NPRF   G    +VCN+K  G W
Sbjct: 25  LQEGLQVTLQGTTKSFAQRFVVNFQNSFNGNDIAFHFNPRFEEGG---YVVCNTKQNGQW 81

Query: 66  GAEQRESAFPFQPGSVVE---VFNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFKI 122
           G E+R+   PFQ G   E   +  +++  + +   +  ++ +R+    ++ ++  G  K+
Sbjct: 82  GPEERKMQMPFQKGMPFELCFLVQRSEFKVMVNKKFFVQYQHRVPYHLVDTIAVSGCLKL 141

Query: 123 KCVAFE 128
             + F+
Sbjct: 142 SFITFQ 147



 Score =  126 bits (318), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 36/123 (29%), Positives = 55/123 (44%), Gaps = 12/123 (9%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAE 68
           L P + + + G V  DA  F +NL  G D     NPRFN     N +V N++   +WG E
Sbjct: 202 LYPSKSIMISGNVLPDATRFHINLRCGGDIAFHLNPRFN----ENAVVRNTQINNSWGQE 257

Query: 69  QRE--SAFPFQPGSVV---EVFNQTDLTIKLPDGYEFKFPNRL-NLEAINYLSAGGDFKI 122
           +R      PF  G       +       + +   +  ++ +RL NL+ IN L   GD ++
Sbjct: 258 ERSLLGRMPFSRGQSFSVWIICEGHCFKVAVNGQHMCEYYHRLKNLQDINTLEVAGDIQL 317

Query: 123 KCV 125
             V
Sbjct: 318 THV 320


>sp|Q3MHZ8|LEG9_BOVIN RecName: Full=Galectin-9
 gb|AAI04506.1| Lectin, galactoside-binding, soluble, 9 [Bos taurus]
          Length = 355

 Score =  139 bits (351), Expect = 9e-32,   Method: Composition-based stats.
 Identities = 33/127 (25%), Positives = 58/127 (45%), Gaps = 12/127 (9%)

Query: 11  LKPGECLRVRGEV-AADAKSFLLNLG-----KDDNNLCNPRFNAHGDVNTIVCNSKDAGA 64
           L+ G  + + G V  +    F +NL       D     NPRF   G    +VCN+K  G+
Sbjct: 25  LQDGHKITIIGAVLPSGGNRFAVNLQTGYNDSDIAFHFNPRFEEGG---YVVCNTKQRGS 81

Query: 65  WGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFK 121
           WG E+R+   PFQ G   E+      +D  + +      ++ +R+    I+ +S  G  +
Sbjct: 82  WGTEERKMHMPFQRGCSFELCFQVQSSDFRVMVNGNLFTQYAHRVPFHRIDAISITGVVQ 141

Query: 122 IKCVAFE 128
           +  ++F+
Sbjct: 142 LSSISFQ 148



 Score =  122 bits (306), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 40/123 (32%), Positives = 61/123 (49%), Gaps = 12/123 (9%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAE 68
           L P + + V G +   A+ F +NL  G D     NPRFN     N +V N++  G+WG+E
Sbjct: 235 LYPSKSILVSGTILPSAQRFYINLRSGSDIAFHLNPRFN----ENAVVRNTQINGSWGSE 290

Query: 69  QRE--SAFPFQPGSVVEVFNQTD---LTIKLPDGYEFKFPNRL-NLEAINYLSAGGDFKI 122
           +R      PF  G    V+   +     + +   + F++ +RL NL AIN L  GGD ++
Sbjct: 291 ERSLPRGMPFFRGQSFSVWIMCEGHCFKVAVDSQHLFEYHHRLKNLPAINNLEVGGDIQL 350

Query: 123 KCV 125
             V
Sbjct: 351 THV 353


>gb|AAA48626.1| 16 kDa beta-galactoside-binding lectin
          Length = 117

 Score =  138 bits (350), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 56/115 (48%), Positives = 83/115 (72%), Gaps = 7/115 (6%)

Query: 3   GLVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNN---LCNPRFNAHGDVNTIVCNS 59
           GLV + L+++PGEC++V+G++ +DAK F +N+GKD +      NPRF+ HGDVNT+VCNS
Sbjct: 4   GLVVTQLDVQPGECVKVKGKILSDAKGFSVNVGKDSSTLMLHFNPRFDCHGDVNTVVCNS 63

Query: 60  KDAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAI 111
           K+ G WG E R++ FPFQ G  VE+   F+  ++ +K+P+   F+FPNRL +E I
Sbjct: 64  KEDGTWGEEDRKADFPFQQGDKVEICISFDAAEVKVKVPEVE-FEFPNRLGMEKI 117


>ref|XP_001083444.1| PREDICTED: lectin, galactoside-binding, soluble, 7 (galectin 7)
           [Macaca mulatta]
          Length = 136

 Score =  138 bits (350), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 39/122 (31%), Positives = 59/122 (48%), Gaps = 5/122 (4%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAE 68
           ++PG  LR+RG V  +A  F +NL  G++ ++     FN   D + +V NSK+ G+WG E
Sbjct: 14  IRPGTVLRIRGLVPPNASRFHINLLCGEEQDSDAALHFNPRLDTSEVVFNSKEQGSWGRE 73

Query: 69  QRESAFPFQPGSVVEVFN---QTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFKIKCV 125
           +R    PFQ G   EV            + D     F +RL L  +  +  GGD ++  V
Sbjct: 74  ERGPGVPFQRGQPFEVLIIASDDGFKAVVGDAQYHHFRHRLPLARVRLVEVGGDVQLDSV 133

Query: 126 AF 127
             
Sbjct: 134 KI 135


>ref|XP_001375542.1| PREDICTED: similar to lectin, galactoside-binding, soluble, 9
           (galectin 9), [Monodelphis domestica]
          Length = 519

 Score =  138 bits (349), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 31/136 (22%), Positives = 61/136 (44%), Gaps = 14/136 (10%)

Query: 2   CGLVASNLNLKPGECLRVRGEVA-ADAKSFLLNL-----GKDDNNLCNPRFNAHGDVNTI 55
           CG +     L+ G  + V G V  +    F +N      G +     NPRF+     + +
Sbjct: 231 CGPIPGG--LQVGHEVTVNGAVLRSGTNRFSVNFQCGFDGNNIAFHFNPRFDGG---SYV 285

Query: 56  VCNSKDAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAIN 112
           VCN+K +G+WG E+R+   PF  G   E+         ++ +   Y  ++ +R+  + ++
Sbjct: 286 VCNTKHSGSWGPEERKMQMPFTKGMPFEIRFQLQNEAFSVIVNGNYFLRYEHRMAFQKVD 345

Query: 113 YLSAGGDFKIKCVAFE 128
            ++  G   +  + F+
Sbjct: 346 TIAIEGMVMVSFIRFQ 361



 Score =  115 bits (288), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 37/123 (30%), Positives = 57/123 (46%), Gaps = 12/123 (9%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAE 68
           L P   + V G +   A  F +NL  G D     NPRF      N +V N++   +WG+E
Sbjct: 399 LYPNRIILVSGSILPTANRFEINLKCGNDIAFHLNPRF----CENAVVRNTQINRSWGSE 454

Query: 69  QRE--SAFPFQPGSVVEVFNQTD---LTIKLPDGYEFKFPNRL-NLEAINYLSAGGDFKI 122
           +R      PF  G    V  + D   L + +   ++F + +R+ NL +IN L   GD ++
Sbjct: 455 ERGLPGCMPFARGQSFMVCIRCDVPCLKVTVNGCHQFDYKHRIRNLLSINQLEVSGDIQL 514

Query: 123 KCV 125
             V
Sbjct: 515 TQV 517


>ref|NP_598283.1| lectin, galactoside-binding, soluble 2 [Rattus norvegicus]
 sp|Q9Z144|LEG2_RAT RecName: Full=Galectin-2
 dbj|BAA74954.1| galectin-2 related protein [Rattus norvegicus]
 gb|EDM15846.1| lectin, galactoside-binding, soluble 2, isoform CRA_a [Rattus
           norvegicus]
          Length = 130

 Score =  138 bits (349), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 51/126 (40%), Positives = 71/126 (56%), Gaps = 5/126 (3%)

Query: 6   ASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNLCNPRFNAHGDVNTIVCNSKDAGAW 65
            +NLN+K G  L+++G++  D  SF +NLG+    L N  FN   + +TIVCN+ D  +W
Sbjct: 7   VTNLNMKSGMSLKIKGKIHNDVNSFTINLGQGKETL-NLHFNPRFNESTIVCNTLDGSSW 65

Query: 66  GAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFKI 122
           G EQRE+   F PGS V++   F   D  + LPDG+   FPNRL    + YLS  G  +I
Sbjct: 66  GQEQRENHSCFSPGSEVKLTLTFQDKDFKVTLPDGHSLTFPNRLGHNHLRYLSMDG-LQI 124

Query: 123 KCVAFE 128
                E
Sbjct: 125 SSFKLE 130


>ref|XP_001507412.1| PREDICTED: similar to promyelocytic leukemia zinc finger protein;
           kruppel-like zinc finger protein; PLZF [Ornithorhynchus
           anatinus]
          Length = 266

 Score =  138 bits (349), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 38/132 (28%), Positives = 59/132 (44%), Gaps = 12/132 (9%)

Query: 5   VASNLNLKPG----ECLRVRGEVAADAKSFLLNLGKDDNN---LCNPRFNAHGDVNTIVC 57
           V   L L+ G      + + G V   A    L+  K  N+     NPRFN   +   IVC
Sbjct: 131 VPYELPLQTGFMPRTMITIVGTVNPQANRLALDFKKGPNDVVFHFNPRFNE-DNKRVIVC 189

Query: 58  NSKDAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRL-NLEAINY 113
           NSK    WG E+R+S FPF+ G   ++          + + D +  ++ +R+ +L  I  
Sbjct: 190 NSKLDNNWGREERQSTFPFEAGKPFKIMVLCETDHFKVAVNDAHLLQYNHRMRDLNQITG 249

Query: 114 LSAGGDFKIKCV 125
           L+  GD  +  V
Sbjct: 250 LAISGDITLTSV 261


>ref|NP_001005958.1| lectin, galactoside-binding, soluble, 1 (galectin 1)-like 1 [Danio
           rerio]
 gb|AAH83310.1| Lectin, galactoside-binding, soluble, 1 (galectin 1)-like 1 [Danio
           rerio]
 gb|AAI64225.1| Lgals1l1 protein [Danio rerio]
          Length = 134

 Score =  138 bits (349), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 41/128 (32%), Positives = 64/128 (50%), Gaps = 6/128 (4%)

Query: 4   LVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNLC---NPRFNAHGDVNTIVCNSK 60
           ++  N+  K G+ L + G   +++  F +N+G    ++    NPRF+AHGD   IVCN+ 
Sbjct: 4   VLIQNMAFKAGQTLTLTGVPKSESSEFKINIGNSSEDIALHINPRFDAHGDQCIIVCNTF 63

Query: 61  DAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAG 117
               W  E RE+ FPF  G   ++   F   +  + LPD  E  FPNR   E   Y+   
Sbjct: 64  QNDCWCEEHRETNFPFVQGEEFQIKITFTNEEFLVTLPDDSEIHFPNRQGSEKYKYMHFE 123

Query: 118 GDFKIKCV 125
           G  +I+ +
Sbjct: 124 GQARIQGI 131


>ref|XP_001375560.1| PREDICTED: similar to galectin-9 [Monodelphis domestica]
          Length = 280

 Score =  138 bits (349), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 31/126 (24%), Positives = 58/126 (46%), Gaps = 12/126 (9%)

Query: 11  LKPGECLRVRGEVAADA-KSFLLNL-----GKDDNNLCNPRFNAHGDVNTIVCNSKDAGA 64
           L+ G  + + G V   +   F +N      G D     NPRF    D   +VCN+K  G 
Sbjct: 25  LQDGLEITINGMVLPSSGNRFDVNFQLGTSGNDIAFHFNPRFE---DGGYVVCNTKQNGC 81

Query: 65  WGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFK 121
           WG E+R+   PFQ G++ E+          + +   Y  ++ +R+  + ++ ++  G  +
Sbjct: 82  WGKEERKGPMPFQRGALFEIRFQVQNASFKVMVNGNYFAEYQHRIPFQWVDTITVNGMVQ 141

Query: 122 IKCVAF 127
           +  ++F
Sbjct: 142 LAYISF 147



 Score =  110 bits (276), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 42/123 (34%), Positives = 55/123 (44%), Gaps = 12/123 (9%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAE 68
           L  G+ L V G +   A SF +NL  G D     NPRF      NTIV NS     WG E
Sbjct: 160 LHAGKFLLVLGSILPTADSFEINLRSGNDIAFHLNPRF----QENTIVRNSHINYLWGPE 215

Query: 69  QR--ESAFPFQPGSVVEVFNQTD---LTIKLPDGYEFKFPNRL-NLEAINYLSAGGDFKI 122
           +R   S  PF  G    V    +     + +   Y F + +R+ NL +IN L   GD ++
Sbjct: 216 ERALSSVMPFIKGQTFMVLITCEAQGFKVTVNGQYLFSYSHRVKNLSSINQLEVAGDIQL 275

Query: 123 KCV 125
             V
Sbjct: 276 THV 278


>ref|XP_001517844.1| PREDICTED: similar to urate transporter/channel protein, isoform
           (UATp,i), partial [Ornithorhynchus anatinus]
          Length = 212

 Score =  138 bits (348), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 33/127 (25%), Positives = 57/127 (44%), Gaps = 12/127 (9%)

Query: 11  LKPGECLRVRGEVA-ADAKSFLLNLGK-----DDNNLCNPRFNAHGDVNTIVCNSKDAGA 64
           LK G  + + G V    +  F +NL       D     NPRF    D N +VCN+K+   
Sbjct: 12  LKDGLQIIINGTVLLTGSNRFAVNLQCGGNDEDIAFHFNPRFE---DGNYVVCNTKEKDK 68

Query: 65  WGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFK 121
           WG E+R+   PFQ G   E+      +   + +   Y  ++ +RL    ++ ++  G  +
Sbjct: 69  WGKEERKMKMPFQKGLPFEIRILVQSSSFLVTVNGSYFLEYQHRLPFHRVDTINVQGSVR 128

Query: 122 IKCVAFE 128
           +  + F+
Sbjct: 129 LTFIDFQ 135


>pdb|2EAK|A Chain A, Crystal Structure Of Human Galectin-9 N-Terminal Crd In
           Complex With Lactose
 pdb|2EAK|B Chain B, Crystal Structure Of Human Galectin-9 N-Terminal Crd In
           Complex With Lactose
 pdb|2EAK|C Chain C, Crystal Structure Of Human Galectin-9 N-Terminal Crd In
           Complex With Lactose
 pdb|2EAL|A Chain A, Crystal Structure Of Human Galectin-9 N-Terminal Crd In
           Complex With Forssman Pentasaccharide
 pdb|2EAL|B Chain B, Crystal Structure Of Human Galectin-9 N-Terminal Crd In
           Complex With Forssman Pentasaccharide
 pdb|2ZHK|A Chain A, Crystal Structure Of Human Galectin-9 N-Terminal Crd In
           Complex With N-Acetyllactosamine Dimer (Crystal 1)
 pdb|2ZHK|B Chain B, Crystal Structure Of Human Galectin-9 N-Terminal Crd In
           Complex With N-Acetyllactosamine Dimer (Crystal 1)
 pdb|2ZHL|A Chain A, Crystal Structure Of Human Galectin-9 N-Terminal Crd In
           Complex With N-Acetyllactosamine Dimer (Crystal 2)
 pdb|2ZHL|B Chain B, Crystal Structure Of Human Galectin-9 N-Terminal Crd In
           Complex With N-Acetyllactosamine Dimer (Crystal 2)
 pdb|2ZHL|C Chain C, Crystal Structure Of Human Galectin-9 N-Terminal Crd In
           Complex With N-Acetyllactosamine Dimer (Crystal 2)
 pdb|2ZHL|D Chain D, Crystal Structure Of Human Galectin-9 N-Terminal Crd In
           Complex With N-Acetyllactosamine Dimer (Crystal 2)
 pdb|2ZHM|A Chain A, Crystal Structure Of Human Galectin-9 N-Terminal Crd In
           Complex With N-Acetyllactosamine Trimer (Crystal 1)
 pdb|2ZHM|B Chain B, Crystal Structure Of Human Galectin-9 N-Terminal Crd In
           Complex With N-Acetyllactosamine Trimer (Crystal 1)
 pdb|2ZHM|C Chain C, Crystal Structure Of Human Galectin-9 N-Terminal Crd In
           Complex With N-Acetyllactosamine Trimer (Crystal 1)
 pdb|2ZHM|D Chain D, Crystal Structure Of Human Galectin-9 N-Terminal Crd In
           Complex With N-Acetyllactosamine Trimer (Crystal 1)
 pdb|2ZHN|A Chain A, Crystal Structure Of Human Galectin-9 N-Terminal Crd In
           Complex With N-Acetyllactosamine Trimer (Crystal 2)
          Length = 148

 Score =  138 bits (348), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 31/127 (24%), Positives = 60/127 (47%), Gaps = 12/127 (9%)

Query: 11  LKPGECLRVRGEVAADA-KSFLLNL-----GKDDNNLCNPRFNAHGDVNTIVCNSKDAGA 64
           L+ G  + V G V + +   F +N      G D     NPRF    D   +VCN++  G+
Sbjct: 25  LQDGLQITVNGTVLSSSGTRFAVNFQTGFSGNDIAFHFNPRFE---DGGYVVCNTRQNGS 81

Query: 65  WGAEQRESAFPFQPGSVVE---VFNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFK 121
           WG E+R++  PFQ G   +   +   +D  + +      ++ +R+    ++ +S  G  +
Sbjct: 82  WGPEERKTHMPFQKGMPFDLCFLVQSSDFKVMVNGILFVQYFHRVPFHRVDTISVNGSVQ 141

Query: 122 IKCVAFE 128
           +  ++F+
Sbjct: 142 LSYISFQ 148


>ref|NP_001034266.1| galectin-9 isoform 1 [Bos taurus]
          Length = 355

 Score =  138 bits (348), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 32/127 (25%), Positives = 58/127 (45%), Gaps = 12/127 (9%)

Query: 11  LKPGECLRVRGEV-AADAKSFLLNLG-----KDDNNLCNPRFNAHGDVNTIVCNSKDAGA 64
           L+ G  + + G V  +    F +NL       D     NPRF   G    +VCN+K  G+
Sbjct: 25  LQDGHKITIIGAVLPSGGNRFAVNLQTGYNDSDIAFHFNPRFEEGG---YVVCNTKQRGS 81

Query: 65  WGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFK 121
           WG E+R+   PFQ G   E+      ++  + +      ++ +R+    I+ +S  G  +
Sbjct: 82  WGTEERKMHMPFQRGCSFELCFQVQSSEFRVMVNGNLFTQYAHRVPFHRIDAISITGVVQ 141

Query: 122 IKCVAFE 128
           +  ++F+
Sbjct: 142 LSSISFQ 148



 Score =  122 bits (306), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 40/123 (32%), Positives = 61/123 (49%), Gaps = 12/123 (9%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAE 68
           L P + + V G +   A+ F +NL  G D     NPRFN     N +V N++  G+WG+E
Sbjct: 235 LYPSKSILVSGTILPSAQRFYINLRSGSDIAFHLNPRFN----ENAVVRNTQINGSWGSE 290

Query: 69  QRE--SAFPFQPGSVVEVFNQTD---LTIKLPDGYEFKFPNRL-NLEAINYLSAGGDFKI 122
           +R      PF  G    V+   +     + +   + F++ +RL NL AIN L  GGD ++
Sbjct: 291 ERSLPRGMPFFRGQSFSVWIMCEGHCFKVAVDSQHLFEYHHRLKNLPAINNLEVGGDIQL 350

Query: 123 KCV 125
             V
Sbjct: 351 THV 353


>gb|AAH42911.2| LGALS7B protein [Homo sapiens]
          Length = 133

 Score =  138 bits (348), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 39/122 (31%), Positives = 58/122 (47%), Gaps = 5/122 (4%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAE 68
           ++PG  LR+RG V  +A  F +NL  G++  +     FN   D + +V NSK+ G+WG E
Sbjct: 11  IRPGTVLRIRGLVPPNASRFHVNLLCGEEQGSDAALHFNPRLDTSEVVFNSKEQGSWGRE 70

Query: 69  QRESAFPFQPGSVVEVFN---QTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFKIKCV 125
           +R    PFQ G   EV            + D     F +RL L  +  +  GGD ++  V
Sbjct: 71  ERGPGVPFQRGQPFEVLIIASDDGFKAVVGDAQYHHFRHRLPLARVRLVEVGGDVQLDSV 130

Query: 126 AF 127
             
Sbjct: 131 RI 132


>sp|P97840|LEG9_RAT RecName: Full=Galectin-9; AltName: Full=36 kDa
           beta-galactoside-binding lectin; AltName: Full=Urate
           transporter/channel; Short=UAT
 gb|AAB68592.1| 36 Kd beta-galactoside binding lectin [Rattus norvegicus]
          Length = 354

 Score =  137 bits (347), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 30/126 (23%), Positives = 56/126 (44%), Gaps = 11/126 (8%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL-----GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAW 65
           L+ G  + ++G V        +N      G D     NPRF   G    +VCN+K  G W
Sbjct: 25  LQNGLQITLQGTVHPFPNRIAVNFQTGFSGNDIAFHFNPRFEEGG---YVVCNTKQNGKW 81

Query: 66  GAEQRESAFPFQPGSVVE---VFNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFKI 122
           G E+R+   PFQ G   E   +  +++  + +   +  ++ +R+    ++ +S  G   +
Sbjct: 82  GPEERKMQMPFQKGMPFELCFLVQRSEFKVMVNKNFFVQYSHRVPYHLVDTISVSGCLHL 141

Query: 123 KCVAFE 128
             + F+
Sbjct: 142 SFINFQ 147



 Score =  121 bits (304), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 35/123 (28%), Positives = 53/123 (43%), Gaps = 12/123 (9%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAE 68
             P + + + G V  DAK F +NL  G D     NPRFN       +V N++   +WG E
Sbjct: 234 FYPSKSINISGVVLPDAKRFHINLRCGGDIAFHLNPRFN----EKVVVRNTQINNSWGPE 289

Query: 69  QRE--SAFPFQPGSVV---EVFNQTDLTIKLPDGYEFKFPNRL-NLEAINYLSAGGDFKI 122
           +R      PF  G       +       + +   +  ++ +RL NL  IN L   GD ++
Sbjct: 290 ERSLPGRMPFNRGQSFSVWILCEGHCFKVAVDGQHICEYYHRLKNLPDINTLEVAGDIQL 349

Query: 123 KCV 125
             V
Sbjct: 350 THV 352


>ref|NP_002298.1| galectin-7 [Homo sapiens]
 ref|NP_001035972.1| galectin-7B [Homo sapiens]
 ref|XP_001721023.1| PREDICTED: similar to galectin-7 [Homo sapiens]
 sp|P47929|LEG7_HUMAN RecName: Full=Galectin-7; Short=Gal-7; AltName: Full=HKL-14;
           AltName: Full=PI7; AltName: Full=p53-induced gene 1
           protein
 gb|AAA67899.1| galectin-7
 gb|AAA86820.1| keratinocyte lectin 14
 gb|AAH61588.1| Lectin, galactoside-binding, soluble, 7B [Homo sapiens]
 emb|CAG33198.1| LGALS7 [Homo sapiens]
 gb|AAH73743.1| Lectin, galactoside-binding, soluble, 7B [Homo sapiens]
 gb|EAW56817.1| hCG1776519 [Homo sapiens]
 gb|EAW56818.1| hCG42850 [Homo sapiens]
          Length = 136

 Score =  137 bits (347), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 39/122 (31%), Positives = 58/122 (47%), Gaps = 5/122 (4%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAE 68
           ++PG  LR+RG V  +A  F +NL  G++  +     FN   D + +V NSK+ G+WG E
Sbjct: 14  IRPGTVLRIRGLVPPNASRFHVNLLCGEEQGSDAALHFNPRLDTSEVVFNSKEQGSWGRE 73

Query: 69  QRESAFPFQPGSVVEVFN---QTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFKIKCV 125
           +R    PFQ G   EV            + D     F +RL L  +  +  GGD ++  V
Sbjct: 74  ERGPGVPFQRGQPFEVLIIASDDGFKAVVGDAQYHHFRHRLPLARVRLVEVGGDVQLDSV 133

Query: 126 AF 127
             
Sbjct: 134 RI 135


>ref|NP_001082394.1| galectin family xgalectin-VIIIa [Xenopus laevis]
 gb|AAI29738.1| Xgalectin-VIIIa protein [Xenopus laevis]
          Length = 315

 Score =  137 bits (347), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 32/128 (25%), Positives = 53/128 (41%), Gaps = 14/128 (10%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNLGK--------DDNNLCNPRFNAHGDVNTIVCNSKDA 62
           L+PG+ + + G V  DA  F ++  +        D     NPRF   G    IVCN+ + 
Sbjct: 25  LEPGQMIVIHGTVHPDADRFQIDFQRGNSVQPRSDVAFHFNPRFKGSG---HIVCNTLEN 81

Query: 63  GAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGD 119
             WG E++    PF  G   E+          +         + +R++L+ ++ L   G 
Sbjct: 82  EKWGWEEKTYQMPFTKGQPFEIIFLVFHDKFQVSSNGKNLLVYKHRISLQRVDTLGISGK 141

Query: 120 FKIKCVAF 127
            KI  + F
Sbjct: 142 VKINTIGF 149



 Score =  108 bits (270), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 29/123 (23%), Positives = 53/123 (43%), Gaps = 5/123 (4%)

Query: 10  NLKPGECLRVRGEVAADAKSFLLNLGKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAEQ 69
            L PG+ + ++GEV  +AK F ++L    +       N        V N+    +WG E+
Sbjct: 192 PLIPGKTMVIKGEVLKNAKRFAIDLKPHGSKDIALHLNPRMKERVFVRNTYLRESWGEEE 251

Query: 70  RE-SAFPFQPGSVVEVFNQTD---LTIKLPDGYEFKFPNRL-NLEAINYLSAGGDFKIKC 124
           ++   FPF      E+    D     + +   +  ++ +R  +L  IN +S  GD ++  
Sbjct: 252 KQLLDFPFCTEMYFEILIYCDLQQFRVAVNGVHLLEYKHRFKDLNKINEVSVNGDIQLHD 311

Query: 125 VAF 127
           V  
Sbjct: 312 VRI 314


>dbj|BAC55887.1| galectin family xgalectin-VIIIa [Xenopus laevis]
          Length = 315

 Score =  137 bits (347), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 32/128 (25%), Positives = 53/128 (41%), Gaps = 14/128 (10%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNLGK--------DDNNLCNPRFNAHGDVNTIVCNSKDA 62
           L+PG+ + + G V  DA  F ++  +        D     NPRF   G    IVCN+ + 
Sbjct: 25  LEPGQMIVIHGTVHPDADRFQIDFQRGNSVQPRSDVAFHFNPRFKGSG---HIVCNTLEN 81

Query: 63  GAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGD 119
             WG E++    PF  G   E+          +         + +R++L+ ++ L   G 
Sbjct: 82  EKWGWEEKTYQMPFTKGQPFEIIFLVFHDKFQVSSNGKNLLVYKHRISLQRVDTLGISGK 141

Query: 120 FKIKCVAF 127
            KI  + F
Sbjct: 142 VKINTIGF 149



 Score =  110 bits (276), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 30/123 (24%), Positives = 54/123 (43%), Gaps = 5/123 (4%)

Query: 10  NLKPGECLRVRGEVAADAKSFLLNLGKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAEQ 69
            L PG+ + ++GEV  +AK F ++L    +       N        V N+    +WG E+
Sbjct: 192 PLIPGKTMVIKGEVLKNAKRFAIDLKPHGSKDIALHLNPRMKERVFVRNTYLRESWGEEE 251

Query: 70  RE-SAFPFQPGSVVEVFNQTD---LTIKLPDGYEFKFPNRL-NLEAINYLSAGGDFKIKC 124
           ++   FPF P    E+    D     + +   +  ++ +R  +L  IN +S  GD ++  
Sbjct: 252 KQLLDFPFCPEMYFEILIYCDLQQFRVAVNGVHLLEYKHRFKDLNKINEVSVNGDIQLHD 311

Query: 125 VAF 127
           V  
Sbjct: 312 VRI 314


>gb|ACI33460.1| Galectin-9 [Salmo salar]
 gb|ACN10990.1| Galectin-9 [Salmo salar]
          Length = 387

 Score =  137 bits (347), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 31/127 (24%), Positives = 58/127 (45%), Gaps = 11/127 (8%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL------GKDDNNLCNPRFNAHGDVNTIVCNSKDAGA 64
           L+ G+ + + G +   A  F +NL      G D     NPR+++H     +V N+     
Sbjct: 24  LQEGKTITITGRLHHGADRFHVNLQCGSRAGADIALHFNPRYDSHP--GYVVANTLQQSR 81

Query: 65  WGAEQRESAFPFQPGSVVEVF---NQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFK 121
           WG E+R+   PFQ GS   +     +    +     +   F +R+  +A++ +S  G  +
Sbjct: 82  WGTEERKQHSPFQHGSGFSLVITVQRDGFQLNANGKHFMTFKHRIPFDAVDTISVEGKVE 141

Query: 122 IKCVAFE 128
           +  +AF+
Sbjct: 142 VTSIAFQ 148



 Score =  121 bits (304), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 33/124 (26%), Positives = 49/124 (39%), Gaps = 10/124 (8%)

Query: 8   NLNLKPGECLRVRGEVAADAKSFLLNLGKDDN--NLCNPRFNAHGDVNTIVCNSKDAGAW 65
           N  L PG  + ++G V  +A  F +NL  +       NPRF+       +V NSK    W
Sbjct: 266 NGGLHPGRTINIQGVVNPNANRFNVNLLCNSEIVLHYNPRFDETL----VVRNSKLKDQW 321

Query: 66  GAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLN-LEAINYLSAGGDFK 121
           G E+R    PF  G    +          I +       + +R   L+ +N L   GD  
Sbjct: 322 GKEERSGGMPFHRGQAFTLSISCEAQCYKIVVNGNQTSTYKHRHTLLQQVNVLEVDGDLS 381

Query: 122 IKCV 125
           +  V
Sbjct: 382 LTSV 385


>pdb|3GAL|A Chain A, Crystal Structure Of Human Galectin-7 In Complex With
           Galactosamine
 pdb|3GAL|B Chain B, Crystal Structure Of Human Galectin-7 In Complex With
           Galactosamine
 pdb|4GAL|A Chain A, Crystal Structure Of Human Galectin-7 In Complex With
           Lactose
 pdb|4GAL|B Chain B, Crystal Structure Of Human Galectin-7 In Complex With
           Lactose
 pdb|5GAL|A Chain A, Crystal Structure Of Human Galectin-7 In Complex With N-
           Acetyllactosamine
 pdb|5GAL|B Chain B, Crystal Structure Of Human Galectin-7 In Complex With N-
           Acetyllactosamine
 pdb|2GAL|A Chain A, Crystal Structure Of Human Galectin-7 In Complex With
           Galactose
 pdb|2GAL|B Chain B, Crystal Structure Of Human Galectin-7 In Complex With
           Galactose
 pdb|1BKZ|A Chain A, Crystal Structure Of Human Galectin-7
 pdb|1BKZ|B Chain B, Crystal Structure Of Human Galectin-7
          Length = 135

 Score =  137 bits (346), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 39/122 (31%), Positives = 58/122 (47%), Gaps = 5/122 (4%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAE 68
           ++PG  LR+RG V  +A  F +NL  G++  +     FN   D + +V NSK+ G+WG E
Sbjct: 13  IRPGTVLRIRGLVPPNASRFHVNLLCGEEQGSDAALHFNPRLDTSEVVFNSKEQGSWGRE 72

Query: 69  QRESAFPFQPGSVVEVFN---QTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFKIKCV 125
           +R    PFQ G   EV            + D     F +RL L  +  +  GGD ++  V
Sbjct: 73  ERGPGVPFQRGQPFEVLIIASDDGFKAVVGDAQYHHFRHRLPLARVRLVEVGGDVQLDSV 132

Query: 126 AF 127
             
Sbjct: 133 RI 134


>gb|EDM05383.1| rCG33388, isoform CRA_a [Rattus norvegicus]
          Length = 354

 Score =  137 bits (346), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 30/126 (23%), Positives = 56/126 (44%), Gaps = 11/126 (8%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL-----GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAW 65
           L+ G  + ++G V        +N      G D     NPRF   G    +VCN+K  G W
Sbjct: 25  LQNGLQITLQGTVHPFPNRIAVNFQTGFSGNDIAFHFNPRFEEGG---YVVCNTKQNGKW 81

Query: 66  GAEQRESAFPFQPGSVVE---VFNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFKI 122
           G E+R+   PFQ G   E   +  +++  + +   +  ++ +R+    ++ +S  G   +
Sbjct: 82  GPEERKMQMPFQKGMPFELCFLVQRSEFKVMVNKNFFVQYSHRVPYHLVDTISVSGCLHL 141

Query: 123 KCVAFE 128
             + F+
Sbjct: 142 SFINFQ 147



 Score =  121 bits (304), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 35/123 (28%), Positives = 53/123 (43%), Gaps = 12/123 (9%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAE 68
             P + + + G V  DAK F +NL  G D     NPRFN       +V N++   +WG E
Sbjct: 234 FYPSKSINISGVVLPDAKRFHINLRCGGDIAFHLNPRFN----EKVVVRNTQINNSWGPE 289

Query: 69  QRE--SAFPFQPGSVV---EVFNQTDLTIKLPDGYEFKFPNRL-NLEAINYLSAGGDFKI 122
           +R      PF  G       +       + +   +  ++ +RL NL  IN L   GD ++
Sbjct: 290 ERSLPGRMPFNRGQSFSVWILCEGHCFKVAVDGQHICEYYHRLKNLPDINTLEVAGDIQL 349

Query: 123 KCV 125
             V
Sbjct: 350 THV 352


>pdb|2YY1|A Chain A, Crystal Sturcture Of N-Terminal Domain Of Human Galectin-9
           Containing L-Acetyllactosamine
          Length = 160

 Score =  137 bits (346), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 31/126 (24%), Positives = 59/126 (46%), Gaps = 12/126 (9%)

Query: 11  LKPGECLRVRGEVAADA-KSFLLNL-----GKDDNNLCNPRFNAHGDVNTIVCNSKDAGA 64
           L+ G  + V G V + +   F +N      G D     NPRF    D   +VCN++  G+
Sbjct: 32  LQDGLQITVNGTVLSSSGTRFAVNFQTGFSGNDIAFHFNPRFE---DGGYVVCNTRQNGS 88

Query: 65  WGAEQRESAFPFQPGSVVE---VFNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFK 121
           WG E+R++  PFQ G   +   +   +D  + +      ++ +R+    ++ +S  G  +
Sbjct: 89  WGPEERKTHMPFQKGMPFDLCFLVQSSDFKVMVNGILFVQYFHRVPFHRVDTISVNGSVQ 148

Query: 122 IKCVAF 127
           +  ++F
Sbjct: 149 LSYISF 154


>gb|AAB51192.1| 36 kDa beta-galactoside binding lectin
          Length = 322

 Score =  137 bits (346), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 30/126 (23%), Positives = 56/126 (44%), Gaps = 11/126 (8%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL-----GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAW 65
           L+ G  + ++G V        +N      G D     NPRF   G    +VCN+K  G W
Sbjct: 25  LQNGLQITLQGTVHPFPNRIAVNFQTGFSGNDIAFHFNPRFEEGG---YVVCNTKQNGKW 81

Query: 66  GAEQRESAFPFQPGSVVE---VFNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFKI 122
           G E+R+   PFQ G   E   +  +++  + +   +  ++ +R+    ++ +S  G   +
Sbjct: 82  GPEERKMQMPFQKGMPFELCFLVQRSEFKVMVNKNFFVQYSHRVPYHLVDTISVSGCLHL 141

Query: 123 KCVAFE 128
             + F+
Sbjct: 142 SFINFQ 147



 Score =  120 bits (303), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 35/123 (28%), Positives = 53/123 (43%), Gaps = 12/123 (9%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAE 68
             P + + + G V  DAK F +NL  G D     NPRFN       +V N++   +WG E
Sbjct: 202 FYPSKSINISGVVLPDAKRFHINLRCGGDIAFHLNPRFN----EKVVVRNTQINNSWGPE 257

Query: 69  QRE--SAFPFQPGSVV---EVFNQTDLTIKLPDGYEFKFPNRL-NLEAINYLSAGGDFKI 122
           +R      PF  G       +       + +   +  ++ +RL NL  IN L   GD ++
Sbjct: 258 ERSLPGRMPFNRGQSFSVWILCEGHCFKVAVDGQHICEYYHRLKNLPDINTLEVAGDIQL 317

Query: 123 KCV 125
             V
Sbjct: 318 THV 320


>ref|NP_999097.1| urate transporter/channel protein, isoform (UATp,i) [Sus scrofa]
 emb|CAB44279.1| urate transporter/channel protein, isoform (UATp,i) [Sus scrofa]
          Length = 349

 Score =  137 bits (346), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 31/127 (24%), Positives = 56/127 (44%), Gaps = 12/127 (9%)

Query: 11  LKPGECLRVRGEVA-ADAKSFLLNLG-----KDDNNLCNPRFNAHGDVNTIVCNSKDAGA 64
           L+ G  + + G V  +    F +NL       D     NPRF   G    +VCN+K  G 
Sbjct: 25  LQDGLQITINGTVLMSSGSRFTVNLQTGHSDNDIAFHFNPRFEEGG---YVVCNTKQNGI 81

Query: 65  WGAEQRESAFPFQPGSVVE---VFNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFK 121
           WG E+R+   PFQ G   E   +   +   + +      ++ +R+    ++ +S  G  +
Sbjct: 82  WGPEERKMQMPFQRGHPFELSFLVQSSQFQVTVNGRLFVQYTHRVPFHRVDTISVTGIVQ 141

Query: 122 IKCVAFE 128
           +  ++F+
Sbjct: 142 LSYISFQ 148



 Score =  106 bits (266), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 34/115 (29%), Positives = 50/115 (43%), Gaps = 12/115 (10%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAE 68
           L P + + V G +   A+SF +NL  G D     NPRF      N +V N++   +WG E
Sbjct: 235 LYPSKSIMVSGTILPSAQSFYINLRSGSDIAFHLNPRF----KENAVVRNTQIGSSWGPE 290

Query: 69  QRE--SAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLN-LEAINYLSAG 117
           +R      PF  G    V          + +   + F++ +RL  L  IN L  G
Sbjct: 291 ERGLPRKMPFSRGQSFLVWILCESHCFKVAVDGQHLFEYYHRLKHLPTINSLEVG 345


>emb|CAB44278.1| urate transporter/channel protein (UATp) [Sus scrofa]
          Length = 317

 Score =  137 bits (345), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 31/127 (24%), Positives = 56/127 (44%), Gaps = 12/127 (9%)

Query: 11  LKPGECLRVRGEVA-ADAKSFLLNLG-----KDDNNLCNPRFNAHGDVNTIVCNSKDAGA 64
           L+ G  + + G V  +    F +NL       D     NPRF   G    +VCN+K  G 
Sbjct: 25  LQDGLQITINGTVLMSSGSRFTVNLQTGHSDNDIAFHFNPRFEEGG---YVVCNTKQNGI 81

Query: 65  WGAEQRESAFPFQPGSVVE---VFNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFK 121
           WG E+R+   PFQ G   E   +   +   + +      ++ +R+    ++ +S  G  +
Sbjct: 82  WGPEERKMQMPFQRGHPFELSFLVQSSQFQVTVNGRLFVQYTHRVPFHRVDTISVTGIVQ 141

Query: 122 IKCVAFE 128
           +  ++F+
Sbjct: 142 LSYISFQ 148



 Score =  106 bits (266), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 34/115 (29%), Positives = 50/115 (43%), Gaps = 12/115 (10%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAE 68
           L P + + V G +   A+SF +NL  G D     NPRF      N +V N++   +WG E
Sbjct: 203 LYPSKSIMVSGTILPSAQSFYINLRSGSDIAFHLNPRF----KENAVVRNTQIGSSWGPE 258

Query: 69  QRE--SAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLN-LEAINYLSAG 117
           +R      PF  G    V          + +   + F++ +RL  L  IN L  G
Sbjct: 259 ERGLPRKMPFSRGQSFLVWILCESHCFKVAVDGQHLFEYYHRLKHLPTINSLEVG 313


>ref|NP_001015570.1| galectin-9 isoform 2 [Bos taurus]
 gb|AAX08997.1| galectin 9 short isoform [Bos taurus]
          Length = 323

 Score =  137 bits (345), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 32/127 (25%), Positives = 58/127 (45%), Gaps = 12/127 (9%)

Query: 11  LKPGECLRVRGEV-AADAKSFLLNLG-----KDDNNLCNPRFNAHGDVNTIVCNSKDAGA 64
           L+ G  + + G V  +    F +NL       D     NPRF   G    +VCN+K  G+
Sbjct: 25  LQDGHKITIIGAVLPSGGNRFAVNLQTGYNDSDIAFHFNPRFEEGG---YVVCNTKQRGS 81

Query: 65  WGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFK 121
           WG E+R+   PFQ G   E+      ++  + +      ++ +R+    I+ +S  G  +
Sbjct: 82  WGTEERKMHMPFQRGCSFELCFQVQSSEFRVMVNGNLFTQYAHRVPFHRIDAISITGVVQ 141

Query: 122 IKCVAFE 128
           +  ++F+
Sbjct: 142 LSSISFQ 148



 Score =  121 bits (304), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 40/123 (32%), Positives = 61/123 (49%), Gaps = 12/123 (9%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAE 68
           L P + + V G +   A+ F +NL  G D     NPRFN     N +V N++  G+WG+E
Sbjct: 203 LYPSKSILVSGTILPSAQRFYINLRSGSDIAFHLNPRFN----ENAVVRNTQINGSWGSE 258

Query: 69  QRE--SAFPFQPGSVVEVFNQTD---LTIKLPDGYEFKFPNRL-NLEAINYLSAGGDFKI 122
           +R      PF  G    V+   +     + +   + F++ +RL NL AIN L  GGD ++
Sbjct: 259 ERSLPRGMPFFRGQSFSVWIMCEGHCFKVAVDSQHLFEYHHRLKNLPAINNLEVGGDIQL 318

Query: 123 KCV 125
             V
Sbjct: 319 THV 321


>gb|ACJ60642.1| lectin galactoside-binding soluble 9 protein [Sus scrofa]
          Length = 355

 Score =  137 bits (345), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 31/127 (24%), Positives = 56/127 (44%), Gaps = 12/127 (9%)

Query: 11  LKPGECLRVRGEVA-ADAKSFLLNLG-----KDDNNLCNPRFNAHGDVNTIVCNSKDAGA 64
           L+ G  + + G V  +    F +NL       D     NPRF   G    +VCN+K  G 
Sbjct: 25  LQDGLQITINGTVLMSSGSRFTVNLQTGHSDNDIAFHFNPRFEEGG---YVVCNTKQNGI 81

Query: 65  WGAEQRESAFPFQPGSVVE---VFNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFK 121
           WG E+R+   PFQ G   E   +   +   + +      ++ +R+    ++ +S  G  +
Sbjct: 82  WGPEERKMQMPFQRGHPFELSFLVQSSQFQVTVNGRLFVQYTHRVPFHRVDTISVTGIVQ 141

Query: 122 IKCVAFE 128
           +  ++F+
Sbjct: 142 LSYISFQ 148



 Score =  118 bits (298), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 37/123 (30%), Positives = 55/123 (44%), Gaps = 12/123 (9%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAE 68
           L P + + V G +   A+SF +NL  G D     NPRF      N +V N++   +WG E
Sbjct: 235 LYPSKSIMVSGTILPSAQSFYINLRSGSDIAFHLNPRF----KENAVVRNTQIGSSWGPE 290

Query: 69  QRE--SAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLN-LEAINYLSAGGDFKI 122
           +R      PF  G    V          + +   + F++ +RL  L  IN L  GGD ++
Sbjct: 291 ERGLPRKMPFSRGQSFLVWILCESHCFKVAVDGQHLFEYYHRLKHLPTINSLEVGGDIQL 350

Query: 123 KCV 125
             V
Sbjct: 351 THV 353


>ref|NP_037109.1| lectin, galactoside-binding, soluble, 9 [Rattus norvegicus]
 gb|AAB48591.1| urate transporter/channel [Rattus norvegicus]
 gb|AAH61566.1| Lectin, galactoside-binding, soluble, 9 [Rattus norvegicus]
 gb|EDM05384.1| rCG33388, isoform CRA_b [Rattus norvegicus]
          Length = 322

 Score =  137 bits (345), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 30/126 (23%), Positives = 56/126 (44%), Gaps = 11/126 (8%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL-----GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAW 65
           L+ G  + ++G V        +N      G D     NPRF   G    +VCN+K  G W
Sbjct: 25  LQNGLQITLQGTVHPFPNRIAVNFQTGFSGNDIAFHFNPRFEEGG---YVVCNTKQNGKW 81

Query: 66  GAEQRESAFPFQPGSVVE---VFNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFKI 122
           G E+R+   PFQ G   E   +  +++  + +   +  ++ +R+    ++ +S  G   +
Sbjct: 82  GPEERKMQMPFQKGMPFELCFLVQRSEFKVMVNKNFFVQYSHRVPYHLVDTISVSGCLHL 141

Query: 123 KCVAFE 128
             + F+
Sbjct: 142 SFINFQ 147



 Score =  120 bits (302), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 35/123 (28%), Positives = 53/123 (43%), Gaps = 12/123 (9%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAE 68
             P + + + G V  DAK F +NL  G D     NPRFN       +V N++   +WG E
Sbjct: 202 FYPSKSINISGVVLPDAKRFHINLRCGGDIAFHLNPRFN----EKVVVRNTQINNSWGPE 257

Query: 69  QRE--SAFPFQPGSVV---EVFNQTDLTIKLPDGYEFKFPNRL-NLEAINYLSAGGDFKI 122
           +R      PF  G       +       + +   +  ++ +RL NL  IN L   GD ++
Sbjct: 258 ERSLPGRMPFNRGQSFSVWILCEGHCFKVAVDGQHICEYYHRLKNLPDINTLEVAGDIQL 317

Query: 123 KCV 125
             V
Sbjct: 318 THV 320


>dbj|BAC56327.1| similar to galactose-binding lectin [Bos taurus]
          Length = 102

 Score =  136 bits (344), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 92/101 (91%), Positives = 92/101 (91%), Gaps = 6/101 (5%)

Query: 34  LGKDDNN---LCNPRFNAHGDVNTIVCNSKDAGAWGAEQRESAFPFQPGSVVEV---FNQ 87
           LGKDDNN     NPRFNAHGDVNTIVC SKDAGAWGAEQRESAFPFQPGSVVEV   FNQ
Sbjct: 2   LGKDDNNLCLHFNPRFNAHGDVNTIVCXSKDAGAWGAEQRESAFPFQPGSVVEVCISFNQ 61

Query: 88  TDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFKIKCVAFE 128
           TDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFKIKCVAFE
Sbjct: 62  TDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFKIKCVAFE 102


>ref|NP_956808.1| lectin, galactoside-binding, soluble, 1 (galectin 1)-like 3 [Danio
           rerio]
 gb|AAH55581.1| Lectin, galactoside-binding, soluble, 1 (galectin 1)-like 3 [Danio
           rerio]
 gb|AAI65230.1| Lgals1l3 protein [Danio rerio]
          Length = 119

 Score =  136 bits (344), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 52/118 (44%), Positives = 67/118 (56%), Gaps = 7/118 (5%)

Query: 15  ECLRVRGEVAADAKSFLLNLGKDDNN---LCNPRFNAHGDVNTIVCNSKDAGAWGAEQRE 71
             +++ G+V     +F +N+G DD+      NPRFNAHGD NTIVCNSK  G WG+E RE
Sbjct: 1   MEMKISGKVKPGCDAFSINIGHDDDAIALHFNPRFNAHGDSNTIVCNSKQGG-WGSEHRE 59

Query: 72  SAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFKIKCVA 126
             FPFQ G   ++   FN     IKLP+G    FPNR   +A  ++   GD KI  V 
Sbjct: 60  HCFPFQQGEEFKLSITFNNETFYIKLPEGTMMSFPNRFGDDAFTHVHVKGDVKIISVK 117


>ref|XP_531742.1| PREDICTED: similar to lectin, galactoside-binding, soluble, 2
           isoform 1 [Canis familiaris]
          Length = 130

 Score =  136 bits (343), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 48/126 (38%), Positives = 70/126 (55%), Gaps = 5/126 (3%)

Query: 6   ASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNLCNPRFNAHGDVNTIVCNSKDAGAW 65
             N+++K G  L+++G++A DA  F++NLG+  + L N  FN     + IVCNS+  G W
Sbjct: 7   VMNMDMKLGGTLKIKGKIAGDADGFVINLGQGSDKL-NLHFNPRFHESVIVCNSR-DGNW 64

Query: 66  GAEQRESAFPFQPGSVVE---VFNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFKI 122
           G EQR+    F PGS V+    F      +KLPDG++  FPNRL    ++YL   G  K+
Sbjct: 65  GQEQRDKHMCFSPGSEVKFTVTFENDGFKVKLPDGHQLTFPNRLGHSHLSYLGVQGGLKV 124

Query: 123 KCVAFE 128
                E
Sbjct: 125 SSFKIE 130


>gb|ABM74074.1| galectin-6 [Mus musculus castaneus]
          Length = 301

 Score =  136 bits (343), Expect = 7e-31,   Method: Composition-based stats.
 Identities = 30/126 (23%), Positives = 56/126 (44%), Gaps = 13/126 (10%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL------GKDDNNLCNPRFNAHGDVNTIVCNSKDAGA 64
           L  G    ++G    + + F +N       G D     NPRF+     + +V N K +G 
Sbjct: 27  LSVGMSFYIQGTAKENMRRFQVNFAVGQDDGADVAFHFNPRFDGW---DKVVFNRKQSGR 83

Query: 65  WGAEQRESAFPFQPGSVVEVFNQ---TDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFK 121
           WG E+ E + PFQ G   E+          + +     +++ +RL ++ + +L   GD +
Sbjct: 84  WGKEE-EKSMPFQKGKHFELVFMVMPEHYKVVVNGSPFYEYGHRLPVQMVTHLQVDGDLE 142

Query: 122 IKCVAF 127
           ++ + F
Sbjct: 143 LQSINF 148



 Score = 95.8 bits (238), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 32/124 (25%), Positives = 50/124 (40%), Gaps = 14/124 (11%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL----GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWG 66
                 + ++G V   AK+F +N      +D     NPR       + +V NS   G+WG
Sbjct: 181 FTVRRTIIIKGYVLPTAKTFAINFRVGSSEDIALHINPRI-----GDCLVRNSYMNGSWG 235

Query: 67  AEQRE-SAFPFQPGSVVEVFNQTD---LTIKLPDGYEFKFPNRL-NLEAINYLSAGGDFK 121
            E+R  +  PF PG   ++  +       +     + F F +R   L  IN L   GD  
Sbjct: 236 TEERMVAYNPFGPGQFFDLSIRCGMDRFKVFANGIHLFNFSHRFQALRKINTLEINGDLT 295

Query: 122 IKCV 125
           +  V
Sbjct: 296 LSYV 299


>pdb|2DYC|A Chain A, Crystal Structure Of The N-Terminal Domain Of Mouse
           Galectin-4
          Length = 158

 Score =  136 bits (343), Expect = 7e-31,   Method: Composition-based stats.
 Identities = 28/126 (22%), Positives = 58/126 (46%), Gaps = 12/126 (9%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL------GKDDNNLCNPRFNAHGDVNTIVCNSKDAGA 64
           L  G  + ++G    + + F +N       G D     NPRF+     + +V N+  +G 
Sbjct: 26  LSVGXSVYIQGXAKENXRRFHVNFAVGQDDGADVAFHFNPRFDGW---DKVVFNTXQSGQ 82

Query: 65  WGAEQRESAFPFQPGSVVEVFNQ---TDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFK 121
           WG E+++ + PFQ G   E+          + +     +++ +RL ++ + +L   GD +
Sbjct: 83  WGKEEKKKSXPFQKGKHFELVFXVXPEHYKVVVNGNSFYEYGHRLPVQXVTHLQVDGDLE 142

Query: 122 IKCVAF 127
           ++ + F
Sbjct: 143 LQSINF 148


>ref|XP_001915607.1| PREDICTED: similar to urate transporter/channel protein (UATp),
           partial [Equus caballus]
          Length = 148

 Score =  136 bits (343), Expect = 7e-31,   Method: Composition-based stats.
 Identities = 35/127 (27%), Positives = 59/127 (46%), Gaps = 12/127 (9%)

Query: 11  LKPGECLRVRGEVAADA-KSFLLNLGK-----DDNNLCNPRFNAHGDVNTIVCNSKDAGA 64
           L+ G  + VRG V   +   F +N        D     NPRF   G    +VCN+K  G 
Sbjct: 25  LQEGLEITVRGTVLPSSGTRFAVNFQTGRSDDDIAFHFNPRFEEGGS---VVCNTKKKGL 81

Query: 65  WGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFK 121
           WG E++++  PFQ GS  E+      +   + L      ++P+R+    ++ LS  G  +
Sbjct: 82  WGLEEKKTHLPFQRGSPFELSFLVLSSCFQVMLNGSLFVQYPHRVPFHHVDTLSVTGAVQ 141

Query: 122 IKCVAFE 128
           +  ++F+
Sbjct: 142 LSSISFQ 148


>ref|XP_001330970.1| PREDICTED: hypothetical protein [Danio rerio]
          Length = 134

 Score =  135 bits (342), Expect = 9e-31,   Method: Composition-based stats.
 Identities = 40/131 (30%), Positives = 65/131 (49%), Gaps = 6/131 (4%)

Query: 4   LVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNLC---NPRFNAHGDVNTIVCNSK 60
           ++  N+  K G+ L + G    ++  F +++G    ++    NPRF+AHGD   IVCN+ 
Sbjct: 4   VLIQNMAFKVGQTLTLTGVPKPESPEFTIDIGNSSEDIALHINPRFDAHGDQCIIVCNTF 63

Query: 61  DAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAG 117
               W  E R+  FPF  G   ++   F   +  + LPDG E  FPNR   E   Y++  
Sbjct: 64  QNDCWCEEHRDENFPFVQGEEFQIKITFTNEEFLVTLPDGSEINFPNRQGSEKYKYMNFT 123

Query: 118 GDFKIKCVAFE 128
           G  +I+ +  +
Sbjct: 124 GQARIQGIEIK 134


>ref|XP_002196044.1| PREDICTED: similar to lectin galactoside-binding soluble 2 protein
           [Taeniopygia guttata]
          Length = 257

 Score =  135 bits (341), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 51/124 (41%), Positives = 70/124 (56%), Gaps = 6/124 (4%)

Query: 8   NLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGA 67
           NLN+KPG  L+V+G++ AD   F +NLG    +L    FN   + + IVCNSK +  W A
Sbjct: 135 NLNMKPGNTLKVKGKIFADTVGFSINLGYSSRDLA-LHFNPRFNESVIVCNSKCSDCWQA 193

Query: 68  EQRESAFPFQPGSVVEVFNQ---TDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFKIKC 124
           E R+   PF  G  V+ F +       +KLPDG+E  FPNR     INY+S  G  KI  
Sbjct: 194 EHRDRHLPFFRGCTVKFFIEMLSDKFRVKLPDGHEVCFPNRHGYHNINYISIVGGLKI-- 251

Query: 125 VAFE 128
           ++F+
Sbjct: 252 ISFK 255


>pdb|2D6O|X Chain X, Crystal Structure Of Mouse Galectin-9 N-Terminal Crd In
           Complex With N-Acetyllactosamine Dimer
          Length = 159

 Score =  135 bits (341), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 31/126 (24%), Positives = 61/126 (48%), Gaps = 11/126 (8%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL-----GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAW 65
           L+ G  + ++G   + A+ F++N      G D     NPRF   G    +VCN+K  G W
Sbjct: 27  LQEGLQVTLQGTTKSFAQRFVVNFQNSFNGNDIAFHFNPRFEEGG---YVVCNTKQNGQW 83

Query: 66  GAEQRESAFPFQPGSVVE---VFNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFKI 122
           G E+R+   PFQ G   E   +  +++  + +   +  ++ +R+    ++ ++  G  K+
Sbjct: 84  GPEERKMQMPFQKGMPFELCFLVQRSEFKVMVNKKFFVQYQHRVPYHLVDTIAVSGCLKL 143

Query: 123 KCVAFE 128
             + F+
Sbjct: 144 SFITFQ 149


>pdb|2D6K|A Chain A, Crystal Structure Of Mouse Galectin-9 N-Terminal Crd
           (Crystal Form 1)
 pdb|2D6K|B Chain B, Crystal Structure Of Mouse Galectin-9 N-Terminal Crd
           (Crystal Form 1)
 pdb|2D6L|X Chain X, Crystal Structure Of Mouse Galectin-9 N-Terminal Crd
           (Crystal Form 2)
 pdb|2D6M|A Chain A, Crystal Structure Of Mouse Galectin-9 N-Terminal Crd In
           Complex With Lactose
 pdb|2D6M|B Chain B, Crystal Structure Of Mouse Galectin-9 N-Terminal Crd In
           Complex With Lactose
 pdb|2D6N|A Chain A, Crystal Structure Of Mouse Galectin-9 N-Terminal Crd In
           Complex With N-Acetyllactosamine
 pdb|2D6N|B Chain B, Crystal Structure Of Mouse Galectin-9 N-Terminal Crd In
           Complex With N-Acetyllactosamine
 pdb|2D6P|A Chain A, Crystal Structure Of Mouse Galectin-9 N-Terminal Crd In
           Complex With T-Antigen
 pdb|2D6P|B Chain B, Crystal Structure Of Mouse Galectin-9 N-Terminal Crd In
           Complex With T-Antigen
          Length = 159

 Score =  135 bits (341), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 31/126 (24%), Positives = 61/126 (48%), Gaps = 11/126 (8%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL-----GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAW 65
           L+ G  + ++G   + A+ F++N      G D     NPRF   G    +VCN+K  G W
Sbjct: 27  LQEGLQVTLQGTTKSFAQRFVVNFQNSFNGNDIAFHFNPRFEEGG---YVVCNTKQNGQW 83

Query: 66  GAEQRESAFPFQPGSVVE---VFNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFKI 122
           G E+R+   PFQ G   E   +  +++  + +   +  ++ +R+    ++ ++  G  K+
Sbjct: 84  GPEERKMQMPFQKGMPFELCFLVQRSEFKVMVNKKFFVQYQHRVPYHLVDTIAVSGCLKL 143

Query: 123 KCVAFE 128
             + F+
Sbjct: 144 SFITFQ 149


>gb|ACI66798.1| Galectin-9 [Salmo salar]
          Length = 330

 Score =  135 bits (340), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 31/126 (24%), Positives = 60/126 (47%), Gaps = 11/126 (8%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNLGK------DDNNLCNPRFNAHGDVNTIVCNSKDAGA 64
           L  G+ + V G V   A+ F +NL        D     NPR++   DV  ++CN+     
Sbjct: 33  LHEGKTITVTGRVLPGAQRFHVNLQCGSRGNPDVALHFNPRYDGSKDV--VICNTMQHSK 90

Query: 65  WGAEQRESAFPFQPGSVV---EVFNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFK 121
           WG+E+RE       G+      + N+   ++ +   +  ++ +RL+  +++ +S  G  +
Sbjct: 91  WGSEEREYPASMTRGANFTLMFLVNRDSYSVIVNGAHFMEYLHRLSFSSVDTISVDGGVE 150

Query: 122 IKCVAF 127
           I+ +AF
Sbjct: 151 IQSIAF 156



 Score =  117 bits (293), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 35/121 (28%), Positives = 49/121 (40%), Gaps = 10/121 (8%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNLG--KDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAE 68
           L PG  + ++G V  +A  F +NL          NPRFN     N +V NS     WG E
Sbjct: 212 LYPGRNIIIQGVVNHNADKFCVNLRFNSGVALHFNPRFN----ENIVVRNSLLKEQWGPE 267

Query: 69  QRESAFPFQPGSVVEVFNQTD---LTIKLPDGYEFKFPNR-LNLEAINYLSAGGDFKIKC 124
           +R    PF  G    V    D     + +     F + +R   L+ I+ L   GD  +  
Sbjct: 268 ERTGGMPFYRGQPFTVTIMCDTKCYRVMVNGVQMFSYNHRHFLLQEIDILEVEGDVSLSS 327

Query: 125 V 125
           V
Sbjct: 328 V 328


>ref|NP_001135558.1| lectin, galactoside-binding, soluble, 8 (galectin 8) [Xenopus
           (Silurana) tropicalis]
 gb|AAI68047.1| Unknown (protein for MGC:185482) [Xenopus tropicalis]
          Length = 315

 Score =  135 bits (340), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 35/128 (27%), Positives = 51/128 (39%), Gaps = 14/128 (10%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNLGK--------DDNNLCNPRFNAHGDVNTIVCNSKDA 62
           L+PG+ + V G V +DA  F ++           D     NPRF   G    IVCN+   
Sbjct: 25  LEPGQMVVVHGTVHSDADRFQIDFQCGSSIHPRSDVAFHFNPRFKGSG---HIVCNTLQN 81

Query: 63  GAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGD 119
             WG E++    PF  G   EV          +         + +R+ LE ++ L   G 
Sbjct: 82  EKWGWEEKTYHLPFTKGQPFEVIFLVFHHKFQVSSNGKNLLVYKHRIGLEKVDTLGISGK 141

Query: 120 FKIKCVAF 127
            KI  + F
Sbjct: 142 VKINSIGF 149



 Score =  105 bits (262), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 30/122 (24%), Positives = 53/122 (43%), Gaps = 5/122 (4%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNLGKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAEQR 70
           L PG+ + ++GEV   AK F ++L    +       N        V N+    +WG E+R
Sbjct: 193 LIPGKTVVIKGEVHKYAKRFAIDLKPHGSKDIALHLNPRIKEKVFVRNTYLCESWGEEER 252

Query: 71  E-SAFPFQPGSVVEVFNQTD---LTIKLPDGYEFKFPNRL-NLEAINYLSAGGDFKIKCV 125
               FPF P    E+    +     + +   ++ ++ +R  +L  IN +S  GD ++  V
Sbjct: 253 HLLDFPFCPEMYFEILIFCELQQFKVAVNGVHQLEYKHRFKDLNKINEVSVNGDVELHDV 312

Query: 126 AF 127
             
Sbjct: 313 RI 314


>ref|NP_001116913.1| lectin, galactoside-binding, soluble, 2 [Xenopus (Silurana)
           tropicalis]
 gb|AAI61334.1| Lgals2 protein [Xenopus tropicalis]
          Length = 131

 Score =  134 bits (339), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 53/124 (42%), Positives = 74/124 (59%), Gaps = 4/124 (3%)

Query: 8   NLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGA 67
           NL LK GE L+++G ++ +AK+F  NLGK   ++    FN     NTIVCNSK +  W +
Sbjct: 9   NLELKRGESLKIKGALSGNAKNFSFNLGKSATDI-GLHFNPRLHENTIVCNSKRSNNWES 67

Query: 68  EQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFKIKC 124
           EQR     F PG+  ++   FN  +  +KLPDG+E  FPNR   + + YLS  GDFK+K 
Sbjct: 68  EQRSGHMCFTPGAEAKISIKFNGDNFEVKLPDGHEITFPNRHGYDKMTYLSVKGDFKVKS 127

Query: 125 VAFE 128
             +E
Sbjct: 128 FKYE 131


>sp|O54974|LEG7_MOUSE RecName: Full=Galectin-7; Short=Gal-7
 gb|AAB92566.1| galectin-7 [Mus musculus]
          Length = 136

 Score =  134 bits (339), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 33/122 (27%), Positives = 54/122 (44%), Gaps = 5/122 (4%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAE 68
           ++ G  +R+RG V   A  F +NL  G++        FN   D + +V N+K  G WG E
Sbjct: 14  VRVGTVMRIRGLVPDQAGRFHVNLLCGEEQGADAALHFNPRLDTSEVVFNTKQQGKWGRE 73

Query: 69  QRESAFPFQPGSVVE---VFNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFKIKCV 125
           +R +  PFQ G   E   +  +      + D     F +RL    +  +  GGD ++  +
Sbjct: 74  ERGTGIPFQRGQPFEVLLIATEEGFKAVVGDDEYLHFHHRLPPARVRLVEVGGDVQLHSL 133

Query: 126 AF 127
             
Sbjct: 134 NI 135


>ref|NP_001134305.1| Galectin-3 [Salmo salar]
 gb|ACI66985.1| Galectin-3 [Salmo salar]
 gb|ACN10264.1| Galectin-3 [Salmo salar]
 gb|ACN12620.1| Galectin-3 [Salmo salar]
          Length = 271

 Score =  134 bits (339), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 40/135 (29%), Positives = 65/135 (48%), Gaps = 12/135 (8%)

Query: 5   VASNLNLKPG----ECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVCN 58
           +  +LNL  G      + +RG +  +AK F +NL  G D     NPRFN  G   TIV N
Sbjct: 136 MPYDLNLPNGCYDKMLITIRGTINQNAKMFTINLTKGNDIAMHVNPRFNDQG-KKTIVRN 194

Query: 59  SKDAGAWGAEQRE-SAFPFQPGSVVE---VFNQTDLTIKLPDGYEFKFPNRL-NLEAINY 113
           S+    WG E+RE + FPF  G   E   +   ++  + +   +  +F +R+ ++ +I +
Sbjct: 195 SQIGNTWGKEEREHNHFPFIQGQPFEMKIMCTNSEFKVAVNSSHILEFKHRIRDIHSIKH 254

Query: 114 LSAGGDFKIKCVAFE 128
           L    D  +  V  +
Sbjct: 255 LGIYNDVTLTSVEID 269


>ref|NP_032522.2| lectin, galactose binding, soluble 7 [Mus musculus]
 dbj|BAB22607.1| unnamed protein product [Mus musculus]
 dbj|BAB25887.1| unnamed protein product [Mus musculus]
 gb|AAI16841.1| Lectin, galactose binding, soluble 7 [Mus musculus]
 gb|AAI16839.1| Lectin, galactose binding, soluble 7 [Mus musculus]
 gb|EDL24104.1| lectin, galactose binding, soluble 7, isoform CRA_a [Mus musculus]
 gb|EDL24105.1| lectin, galactose binding, soluble 7, isoform CRA_a [Mus musculus]
          Length = 136

 Score =  134 bits (338), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 32/122 (26%), Positives = 55/122 (45%), Gaps = 5/122 (4%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAE 68
           ++ G  +R+RG V   A  F +NL  G++        FN   D + +V N+K+ G WG E
Sbjct: 14  VRVGTVMRIRGMVPDQAGRFHVNLLCGEEQGADAALHFNPRLDTSEVVFNTKEQGKWGRE 73

Query: 69  QRESAFPFQPGSVVE---VFNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFKIKCV 125
           +R +  PF+ G   E   +  +      + D     F +R+    +  +  GGD ++  V
Sbjct: 74  ERGTGIPFERGQPFEVLLIATEEGFKAVVGDDEYLHFHHRMPPARVRLVEVGGDVQLHSV 133

Query: 126 AF 127
             
Sbjct: 134 KI 135


>ref|XP_861690.1| PREDICTED: similar to lectin, galactoside-binding, soluble, 2
           isoform 2 [Canis familiaris]
          Length = 121

 Score =  134 bits (338), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 47/123 (38%), Positives = 69/123 (56%), Gaps = 5/123 (4%)

Query: 9   LNLKPGECLRVRGEVAADAKSFLLNLGKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAE 68
           +++K G  L+++G++A DA  F++NLG+  + L N  FN     + IVCNS+  G WG E
Sbjct: 1   MDMKLGGTLKIKGKIAGDADGFVINLGQGSDKL-NLHFNPRFHESVIVCNSR-DGNWGQE 58

Query: 69  QRESAFPFQPGSVVE---VFNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFKIKCV 125
           QR+    F PGS V+    F      +KLPDG++  FPNRL    ++YL   G  K+   
Sbjct: 59  QRDKHMCFSPGSEVKFTVTFENDGFKVKLPDGHQLTFPNRLGHSHLSYLGVQGGLKVSSF 118

Query: 126 AFE 128
             E
Sbjct: 119 KIE 121


>ref|NP_001118080.1| VHSV-induced protein-9 [Oncorhynchus mykiss]
 gb|AAM18472.1|AF483533_1 VHSV-induced protein-9 [Oncorhynchus mykiss]
          Length = 348

 Score =  134 bits (338), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 32/126 (25%), Positives = 60/126 (47%), Gaps = 11/126 (8%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNLGK------DDNNLCNPRFNAHGDVNTIVCNSKDAGA 64
           L  G+ + V G V   A+ F +NL        D     NPR+++  DV  ++CN+     
Sbjct: 22  LHEGKTITVTGRVLPGAQRFHVNLQCGSRGNPDIALHFNPRYDSFLDV--VICNTMQHSK 79

Query: 65  WGAEQRESAFPFQPGSVV---EVFNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFK 121
           WG+E+RE   P   G+      + N+   +I +      ++ +RL+   ++ +S  G  +
Sbjct: 80  WGSEEREYFAPMTRGANFTLMFLVNKDSYSIIVNGALFMEYLHRLSFSRVDTISVDGGVE 139

Query: 122 IKCVAF 127
           ++ +AF
Sbjct: 140 VQSIAF 145



 Score =  114 bits (287), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 34/121 (28%), Positives = 47/121 (38%), Gaps = 10/121 (8%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNLG--KDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAE 68
           L PG  + ++G V  +A  F +NL          NPRFN     N +V NS     WG E
Sbjct: 230 LYPGRNITIQGVVNHNADKFCINLRFNSGVAFHFNPRFN----ENVVVRNSLLKEQWGPE 285

Query: 69  QRESAFPFQPGSVVEVFNQTD---LTIKLPDGYEFKFPNR-LNLEAINYLSAGGDFKIKC 124
           +R    PF  G    V    D     + +     F +  R    + I+ L   GD  +  
Sbjct: 286 ERTGGMPFYRGQPFTVIIMCDTQCYRVMVNGALMFSYNPRHFLFQQIDILEVEGDVSLSA 345

Query: 125 V 125
           V
Sbjct: 346 V 346


>ref|XP_001915598.1| PREDICTED: similar to galectin 9, partial [Equus caballus]
          Length = 267

 Score =  134 bits (338), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 35/127 (27%), Positives = 59/127 (46%), Gaps = 12/127 (9%)

Query: 11  LKPGECLRVRGEVAADA-KSFLLNLGK-----DDNNLCNPRFNAHGDVNTIVCNSKDAGA 64
           L+ G  + VRG V   +   F +N        D     NPRF   G    +VCN+K  G 
Sbjct: 12  LQEGLEITVRGTVLPSSGTRFAVNFQTGRSDDDIAFHFNPRFEEGGS---VVCNTKKKGL 68

Query: 65  WGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFK 121
           WG E++++  PFQ GS  E+      +   + L      ++P+R+    ++ LS  G  +
Sbjct: 69  WGLEEKKTHLPFQRGSPFELSFLVLSSCFQVMLNGSLFVQYPHRVPFHHVDTLSVTGAVQ 128

Query: 122 IKCVAFE 128
           +  ++F+
Sbjct: 129 LSSISFQ 135



 Score =  106 bits (266), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 37/123 (30%), Positives = 55/123 (44%), Gaps = 12/123 (9%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAE 68
           L P   + V G +  +A+ F +NL  G D     NPRFN     N++V NS   G+WG E
Sbjct: 147 LYPSRRIIVSGTILPNAQWFRINLRSGSDIAFHLNPRFN----ENSVVRNSLINGSWGHE 202

Query: 69  QRE--SAFPFQPGSVVEVFN---QTDLTIKLPDGYEFKFPNRL-NLEAINYLSAGGDFKI 122
           +R      PF  G    V          + +   ++F + +R+ N  AIN L   G  ++
Sbjct: 203 ERSLWGPMPFIQGQSFTVRITRKAHYFRVAVNGVHKFDYNHRMKNFCAINVLDVAGHIRL 262

Query: 123 KCV 125
             V
Sbjct: 263 THV 265


>ref|XP_001085890.1| PREDICTED: similar to Galectin-3 (Galactose-specific lectin 3)
           (Mac-2 antigen) (IgE-binding protein) (35 kDa lectin)
           (Carbohydrate-binding protein 35) (CBP 35)
           (Laminin-binding protein) (Lectin L-29) (L-31)
           (Galactoside-binding protein) (GALBP)... [Macaca
           mulatta]
          Length = 255

 Score =  133 bits (337), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 36/140 (25%), Positives = 59/140 (42%), Gaps = 18/140 (12%)

Query: 5   VASNLNL----KPGECLRVRGEVAADAKSFLLNLG--KDDNNLCNPRFNAHGDVNTIVCN 58
           V  NL L     P   + + G V  +A    L+     D     NPRFN + +   IVCN
Sbjct: 114 VPYNLPLPGGVVPRMLITILGTVKPNANRIALDFKRRNDVAFHFNPRFNEN-NRRVIVCN 172

Query: 59  SKDAGAWGAEQRESAFPFQPGSVVE----------VFNQTDLTIKLPDGYEFKFPNRLN- 107
           +K    WG E+R+S FPF+ G   +          +       + + D +  ++ +R+  
Sbjct: 173 TKLDNNWGREERQSVFPFESGKPFKFMYMPFQIQVLVESDHFKVAVNDAHLLQYNHRVKQ 232

Query: 108 LEAINYLSAGGDFKIKCVAF 127
           L  I+ L   GD  +   ++
Sbjct: 233 LNEISQLGISGDIDLTNASY 252


>dbj|BAC56326.1| similar to galactose-binding lectin [Bos taurus]
          Length = 95

 Score =  133 bits (337), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 86/91 (94%), Positives = 86/91 (94%), Gaps = 3/91 (3%)

Query: 41  LCNPRFNAHGDVNTIVCNSKDAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDG 97
             NPRFNAHGDVNTIVCNSKDAGAWGAEQRESAFPFQPGSVVEV   FNQTDLTIKLPDG
Sbjct: 5   HFNPRFNAHGDVNTIVCNSKDAGAWGAEQRESAFPFQPGSVVEVCISFNQTDLTIKLPDG 64

Query: 98  YEFKFPNRLNLEAINYLSAGGDFKIKCVAFE 128
           YEFKFPNRLNLEAINYLSAGGDFKIKCVAFE
Sbjct: 65  YEFKFPNRLNLEAINYLSAGGDFKIKCVAFE 95


>ref|XP_002192605.1| PREDICTED: lectin, galactoside-binding, soluble, 8 (galectin 8)
           [Taeniopygia guttata]
          Length = 339

 Score =  133 bits (337), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 36/128 (28%), Positives = 54/128 (42%), Gaps = 14/128 (10%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNLGK--------DDNNLCNPRFNAHGDVNTIVCNSKDA 62
           L PGE + + G V  DA  F ++L          D     NPRF   G    IVCN+ + 
Sbjct: 50  LVPGELIVIHGTVPDDADRFQVDLQCGSSIKPRADVAFHFNPRFKRSG---CIVCNTLER 106

Query: 63  GAWGAEQRESAFPFQPGSVVEVFNQ---TDLTIKLPDGYEFKFPNRLNLEAINYLSAGGD 119
             WG E+     PF  G   E+          + +   +   + +R++LE I+ L   G 
Sbjct: 107 EKWGWEEITYEMPFGKGKSFEIVIMILKDKFQVTVNKKHLLLYNHRISLEKIDTLGIYGK 166

Query: 120 FKIKCVAF 127
            +IK + F
Sbjct: 167 VQIKTIEF 174



 Score =  123 bits (311), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 33/117 (28%), Positives = 54/117 (46%), Gaps = 5/117 (4%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNLGKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAEQR 70
           L+PG  + ++GEV  + KSF +NL   D+       N        V NS    +WG E++
Sbjct: 217 LRPGCTIAIKGEVNKNPKSFAINLRPSDSKDIALHLNPRMKNKVFVRNSYLHDSWGEEEK 276

Query: 71  E-SAFPFQPGSVVEVFNQTD---LTIKLPDGYEFKFPNRLN-LEAINYLSAGGDFKI 122
           E + FPF PG   E+    D     + +   +  ++ +R   LE I+ +   GD  +
Sbjct: 277 EITNFPFSPGMYFELIIFCDAYQFKVAVNGVHTLEYKHRFKQLEKISIVEVTGDVHL 333


>gb|AAH88813.1| Lgals9-prov protein [Xenopus tropicalis]
          Length = 333

 Score =  133 bits (336), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 29/121 (23%), Positives = 53/121 (43%), Gaps = 9/121 (7%)

Query: 13  PGECLRVRGEVAADAKSFLLNLG---KDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAEQ 69
            G+ + ++G V +    F +N      D     NPRF+   D + IVCN+  +  WG+E+
Sbjct: 23  DGKKVTIQGLVHSHCTRFAVNFICFNNDIAFHFNPRFD---DGHVIVCNTMQSSKWGSEE 79

Query: 70  RESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFKIKCVA 126
           R    PF      E+          + +   Y  ++ +R++ ++I  +   GD  +  V 
Sbjct: 80  RTKHMPFNKNGSFEIAILVLGHAFQVSVNGQYILEYRHRVSYQSIQSIQVNGDVSLSVVT 139

Query: 127 F 127
           F
Sbjct: 140 F 140



 Score = 98.9 bits (246), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 25/115 (21%), Positives = 46/115 (40%), Gaps = 4/115 (3%)

Query: 17  LRVRGEVAADAKSFLLNLGKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAEQRESA-FP 75
           + + G V   A  F +NL    +               +V N++D G WG E+R  +  P
Sbjct: 219 IIIVGNVPYGADRFHVNLLNSGSRNIYLHVAPRFKEGALVRNTQDRGTWGPEERHMSYMP 278

Query: 76  FQPGSVVEVFNQTD---LTIKLPDGYEFKFPNRLNLEAINYLSAGGDFKIKCVAF 127
           F PG   ++  + +     + +     F + +RL    I+ +   GD  +  + F
Sbjct: 279 FVPGQQFQMEIRNEGGCFGVSVNSAKVFTYVHRLPGNQIDMMEVAGDVTLTYIQF 333


>pdb|1KJL|A Chain A, High Resolution X-Ray Structure Of Human Galectin-3 In
           Complex With Lacnac
 pdb|1KJR|A Chain A, Crystal Structure Of The Human Galectin-3 Crd In Complex
           With A 3'-Derivative Of N-Acetyllactosamine
          Length = 146

 Score =  133 bits (336), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 37/134 (27%), Positives = 61/134 (45%), Gaps = 11/134 (8%)

Query: 4   LVASNLNL----KPGECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVC 57
           +V  NL L     P   + + G V  +A    L+   G D     NPRFN + +   IVC
Sbjct: 11  IVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNEN-NRRVIVC 69

Query: 58  NSKDAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRL-NLEAINY 113
           N+K    WG E+R+S FPF+ G   ++          + + D +  ++ +R+  L  I+ 
Sbjct: 70  NTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISK 129

Query: 114 LSAGGDFKIKCVAF 127
           L   GD  +   ++
Sbjct: 130 LGISGDIDLTSASY 143


>gb|ABC47040.1| galectin 8 [Sparus aurata]
          Length = 214

 Score =  133 bits (336), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 35/126 (27%), Positives = 55/126 (43%), Gaps = 14/126 (11%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNLGK--------DDNNLCNPRFNAHGDVNTIVCNSKDA 62
           L PGE + V+G V + A  F ++           D     NPRF        IVCN+   
Sbjct: 25  LLPGEMVLVQGSVPSKADRFQIDFTCGSSVKPRADVAFHFNPRFKRSP---CIVCNTLQK 81

Query: 63  GAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGD 119
             WG E+     PF PG+  E+     +    + +  G+  ++ +RL LE ++ L   G 
Sbjct: 82  ERWGREEILYQMPFAPGATFEIIFLVLRDKFKVAVNGGHVLEYQHRLELERVDTLCISGQ 141

Query: 120 FKIKCV 125
            K++ V
Sbjct: 142 VKVQAV 147



 Score = 33.4 bits (76), Expect = 5.9,   Method: Composition-based stats.
 Identities = 9/24 (37%), Positives = 15/24 (62%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL 34
           L  G  + ++GE++  A SF +NL
Sbjct: 191 LSVGRSIAIKGEISQSAHSFSVNL 214


>emb|CAI11728.1| novel protein similar to vertebrate lectin, galactose binding,
           soluble 8 (LGALS8) [Danio rerio]
          Length = 153

 Score =  133 bits (336), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 30/128 (23%), Positives = 56/128 (43%), Gaps = 14/128 (10%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNLGK--------DDNNLCNPRFNAHGDVNTIVCNSKDA 62
           L+PGE + ++G V + +  F ++L          D     NPRF        IVCN+   
Sbjct: 25  LQPGEMVLIQGTVPSGSDRFQVDLTCGSSMKPRADVAFHFNPRFTRSP---YIVCNTLQK 81

Query: 63  GAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGD 119
             WG E+     PF  G+  E+     +    + +   +  ++  R+ L+ ++ L+  G 
Sbjct: 82  ERWGKEEIHYLMPFSHGAAFEIIILVQKDLFKVAVNGSHLLEYRQRVELKKVDTLNISGK 141

Query: 120 FKIKCVAF 127
            +I+ + F
Sbjct: 142 VQIQAIGF 149


>gb|AAI53700.1| Lgals9 protein [Xenopus tropicalis]
          Length = 335

 Score =  133 bits (336), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 29/121 (23%), Positives = 53/121 (43%), Gaps = 9/121 (7%)

Query: 13  PGECLRVRGEVAADAKSFLLNLG---KDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAEQ 69
            G+ + ++G V +    F +N      D     NPRF+   D + IVCN+  +  WG+E+
Sbjct: 25  DGKKVTIQGLVHSHCTRFAVNFICFNNDIAFHFNPRFD---DGHVIVCNTMQSSKWGSEE 81

Query: 70  RESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFKIKCVA 126
           R    PF      E+          + +   Y  ++ +R++ ++I  +   GD  +  V 
Sbjct: 82  RTKHMPFNKNGSFEIAILVLGHAFQVSVNGQYILEYRHRVSYQSIQSIQVNGDVSLSVVT 141

Query: 127 F 127
           F
Sbjct: 142 F 142



 Score = 98.9 bits (246), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 25/115 (21%), Positives = 46/115 (40%), Gaps = 4/115 (3%)

Query: 17  LRVRGEVAADAKSFLLNLGKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAEQRESA-FP 75
           + + G V   A  F +NL    +               +V N++D G WG E+R  +  P
Sbjct: 221 IIIVGNVPYGADRFHVNLLNSGSRNIYLHVAPRFKEGALVRNTQDRGTWGPEERHMSYMP 280

Query: 76  FQPGSVVEVFNQTD---LTIKLPDGYEFKFPNRLNLEAINYLSAGGDFKIKCVAF 127
           F PG   ++  + +     + +     F + +RL    I+ +   GD  +  + F
Sbjct: 281 FVPGQQFQMEIRNEGGCFGVSVNSAKVFTYVHRLPGNQIDMMEVAGDVTLTYIQF 335


>gb|AAB40658.1| galectin-7 [Rattus norvegicus]
          Length = 136

 Score =  133 bits (336), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 35/122 (28%), Positives = 55/122 (45%), Gaps = 5/122 (4%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAE 68
           ++ G  +R+RG V   A  F +NL  G++    C   FN   D + +V N+K  G WG E
Sbjct: 14  VRLGTVMRIRGVVPDQAGRFHVNLLCGEEQEADCALHFNPRLDTSEVVFNTKQQGKWGRE 73

Query: 69  QRESAFPFQPGSVVEVF---NQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFKIKCV 125
           +R +  PFQ G   EV     +      + D     F +R+    +  +  GGD ++  V
Sbjct: 74  ERGTGIPFQRGQPFEVLIITTEEGFKTVIGDDEYLHFHHRMPSSNVRSVEVGGDVQLHSV 133

Query: 126 AF 127
             
Sbjct: 134 KI 135


>dbj|BAB26108.1| unnamed protein product [Mus musculus]
          Length = 136

 Score =  133 bits (335), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 32/122 (26%), Positives = 55/122 (45%), Gaps = 5/122 (4%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAE 68
           ++ G  +R+RG V   A  F +NL  G++        FN   D + +V N+K+ G WG E
Sbjct: 14  VRVGTVMRIRGMVPDQAGRFHVNLLCGEEQGADAALHFNPRLDTSEVVFNTKEQGKWGRE 73

Query: 69  QRESAFPFQPGSVVE---VFNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFKIKCV 125
           +R +  PF+ G   E   +  +      + D     F +R+    +  +  GGD ++  V
Sbjct: 74  ERGTGIPFERGQPFEVLLIATEEGFKAVVGDDEYLHFHHRMPPALVRLVEVGGDVQLHSV 133

Query: 126 AF 127
             
Sbjct: 134 KI 135


>gb|AAF61069.1|AF220550_1 galectin [Paralichthys olivaceus]
          Length = 135

 Score =  133 bits (335), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 44/125 (35%), Positives = 65/125 (52%), Gaps = 6/125 (4%)

Query: 10  NLKPGECLRVRGEVAADAKSFLLNLG---KDDNNLCNPRFNAHGDVNTIVCNSKDAGAWG 66
           + K G+ + + G    DA +F LN+G   +D     NPRFNAHGD N +VCNS     W 
Sbjct: 11  SFKVGQTMTIIGVPKPDATNFALNIGPTDQDIVMHINPRFNAHGDENAVVCNSYIGRQWC 70

Query: 67  AEQRESAFPFQPGSVVEVFNQ---TDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFKIK 123
            E RE  FPFQ G   ++  +    +  + L DG    FPNR+  E  +++S  G+ +I+
Sbjct: 71  EELREGGFPFQLGEEFKIVIEFTPQEFLVTLSDGSIIHFPNRIGAEKYSFMSFEGEARIR 130

Query: 124 CVAFE 128
               +
Sbjct: 131 SFEIK 135


>dbj|BAB83259.1| galectin family xgalectin-IVa [Xenopus laevis]
          Length = 332

 Score =  133 bits (335), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 29/121 (23%), Positives = 52/121 (42%), Gaps = 9/121 (7%)

Query: 13  PGECLRVRGEVAADAKSFLLNL---GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAEQ 69
            G+ + ++G V +    F +N      D     NPRF+   D   IVCN+  +  WG+E+
Sbjct: 24  DGKKVTIQGFVHSHCTRFAVNFVCFNNDIAFHFNPRFD---DGLVIVCNTMQSSKWGSEE 80

Query: 70  RESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFKIKCVA 126
           R+   PF      E+          + +   Y  ++ +R + ++I  +   GD  +  V 
Sbjct: 81  RKKHMPFSKNGAFEITVLVLGHAFQVSVNGQYILEYRHRTSYQSIQSVQVNGDVTLSQVT 140

Query: 127 F 127
           F
Sbjct: 141 F 141



 Score = 97.0 bits (241), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 26/115 (22%), Positives = 45/115 (39%), Gaps = 4/115 (3%)

Query: 17  LRVRGEVAADAKSFLLNLGKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAEQRESA-FP 75
           + + G V   A  F +NL                    +V N++D G WG E+R  +  P
Sbjct: 218 IIMVGSVGYGADRFHVNLLNSSTRNIYLHIAPRFKEGALVRNTQDRGTWGPEERHMSYMP 277

Query: 76  FQPGSVVEVFNQTD---LTIKLPDGYEFKFPNRLNLEAINYLSAGGDFKIKCVAF 127
           F PG   ++  + +     + +     F + +RL    I+ +   GD  +  V F
Sbjct: 278 FVPGQQFQMEIRNEGGCFGVYVNSAKVFTYVHRLPANQIDMMEVNGDVSLSYVQF 332


>gb|AAI08826.1| Xgalectin-iva protein [Xenopus laevis]
          Length = 345

 Score =  133 bits (335), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 29/121 (23%), Positives = 52/121 (42%), Gaps = 9/121 (7%)

Query: 13  PGECLRVRGEVAADAKSFLLNL---GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAEQ 69
            G+ + ++G V +    F +N      D     NPRF+   D   IVCN+  +  WG+E+
Sbjct: 37  DGKKVTIQGFVHSHCTRFAVNFVCFNNDIAFHFNPRFD---DGLVIVCNTMQSSKWGSEE 93

Query: 70  RESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFKIKCVA 126
           R+   PF      E+          + +   Y  ++ +R + ++I  +   GD  +  V 
Sbjct: 94  RKKHMPFSKNGAFEITVLVLGHAFQVSVNGQYILEYRHRTSYQSIQSVQVNGDVTLSQVT 153

Query: 127 F 127
           F
Sbjct: 154 F 154



 Score = 97.0 bits (241), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 26/115 (22%), Positives = 45/115 (39%), Gaps = 4/115 (3%)

Query: 17  LRVRGEVAADAKSFLLNLGKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAEQRESA-FP 75
           + + G V   A  F +NL                    +V N++D G WG E+R  +  P
Sbjct: 231 IIMVGSVGYGADRFHVNLLNSSTRNIYLHIAPRFKEGALVRNTQDRGTWGPEERHMSYMP 290

Query: 76  FQPGSVVEVFNQTD---LTIKLPDGYEFKFPNRLNLEAINYLSAGGDFKIKCVAF 127
           F PG   ++  + +     + +     F + +RL    I+ +   GD  +  V F
Sbjct: 291 FVPGQQFQMEIRNEGGCFGVYVNSAKVFTYVHRLPANQIDMMEVNGDVSLSYVQF 345


>ref|XP_001918023.1| PREDICTED: similar to lectin, galactoside-binding, soluble, 9
           (galectin 9) [Equus caballus]
          Length = 361

 Score =  133 bits (335), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 34/127 (26%), Positives = 59/127 (46%), Gaps = 13/127 (10%)

Query: 11  LKPGECLRVRGEV-AADAKSFLLNLGK-----DDNNLCNPRFNAHGDVNTIVCNSKDAGA 64
           L+ G  + VRG V A+    F +N        D     NP+F   G    +VCN+K+ G 
Sbjct: 24  LQEGLQITVRGTVLASSGTRFAVNFQTGRSDDDIAFHFNPQFEEGG---YLVCNTKEKGR 80

Query: 65  WGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFK 121
           WG E++ +  PFQ  S  E+      +   + L      ++P+R+    ++ LS  G  +
Sbjct: 81  WGQEEK-THLPFQRRSPFELSFLVLSSCFQVMLNGSPFVRYPHRVPFHRVDTLSVTGTVQ 139

Query: 122 IKCVAFE 128
           +  ++F+
Sbjct: 140 LSSISFQ 146



 Score =  102 bits (254), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 36/121 (29%), Positives = 54/121 (44%), Gaps = 12/121 (9%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAE 68
           L P + + V G V   A+SF +NL  G D      P F       T+V N++  G+WG  
Sbjct: 241 LYPSKSIVVSGTVLHSAQSFHINLRSGSDVAFHLKPLF----KEKTVVLNTQIDGSWGHV 296

Query: 69  QRE--SAFPFQPGSVVEVFNQTD---LTIKLPDGYEFKFPNRL-NLEAINYLSAGGDFKI 122
           ++      PF  G    V+   +   L + +   +   + +RL NL AIN L   GD K+
Sbjct: 297 EKTLSGKMPFTRGRSFSVWITCEARCLRVDVDGQHLCDYNHRLKNLHAINVLEVAGDIKL 356

Query: 123 K 123
            
Sbjct: 357 T 357


>gb|AAH84416.1| Xgalectin-iva protein [Xenopus laevis]
          Length = 343

 Score =  133 bits (335), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 29/121 (23%), Positives = 52/121 (42%), Gaps = 9/121 (7%)

Query: 13  PGECLRVRGEVAADAKSFLLNL---GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAEQ 69
            G+ + ++G V +    F +N      D     NPRF+   D   IVCN+  +  WG+E+
Sbjct: 35  DGKKVTIQGFVHSHCTRFAVNFVCFNNDIAFHFNPRFD---DGLVIVCNTMQSSKWGSEE 91

Query: 70  RESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFKIKCVA 126
           R+   PF      E+          + +   Y  ++ +R + ++I  +   GD  +  V 
Sbjct: 92  RKKHMPFSKNGAFEITVLVLGHAFQVSVNGQYILEYRHRTSYQSIQSVQVNGDVTLSQVT 151

Query: 127 F 127
           F
Sbjct: 152 F 152



 Score = 97.0 bits (241), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 26/115 (22%), Positives = 45/115 (39%), Gaps = 4/115 (3%)

Query: 17  LRVRGEVAADAKSFLLNLGKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAEQRESA-FP 75
           + + G V   A  F +NL                    +V N++D G WG E+R  +  P
Sbjct: 229 IIMVGSVGYGADRFHVNLLNSSTRNIYLHIAPRFKEGALVRNTQDRGTWGPEERHMSYMP 288

Query: 76  FQPGSVVEVFNQTD---LTIKLPDGYEFKFPNRLNLEAINYLSAGGDFKIKCVAF 127
           F PG   ++  + +     + +     F + +RL    I+ +   GD  +  V F
Sbjct: 289 FVPGQQFQMEIRNEGGCFGVYVNSAKVFTYVHRLPANQIDMMEVNGDVSLSYVQF 343


>ref|XP_001367884.1| PREDICTED: similar to galectin-7 [Monodelphis domestica]
          Length = 138

 Score =  133 bits (335), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 41/125 (32%), Positives = 58/125 (46%), Gaps = 13/125 (10%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL------GKDDNNLCNPRFNAHGDVNTIVCNSKDAGA 64
           L+PG  +RVRG V  +A  F +NL      G D    CNPR     D   +V N+ + GA
Sbjct: 16  LRPGSVIRVRGTVPDNASRFHVNLLCSEGSGADTALHCNPRL----DTGEMVFNTFEKGA 71

Query: 65  WGAEQRESAFPFQPGSVVEVFN---QTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFK 121
           WG E+R    PFQ G   ++              D    +F +R+ L  +  L  GGD +
Sbjct: 72  WGQEERSPHLPFQRGQPFDLLLIAGDDSFKAVTGDHMFHRFSHRMPLGLVRVLEVGGDVQ 131

Query: 122 IKCVA 126
           ++ VA
Sbjct: 132 LQNVA 136


>gb|AAH97632.1| Xgalectin-iva protein [Xenopus laevis]
          Length = 339

 Score =  133 bits (335), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 29/121 (23%), Positives = 52/121 (42%), Gaps = 9/121 (7%)

Query: 13  PGECLRVRGEVAADAKSFLLNL---GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAEQ 69
            G+ + ++G V +    F +N      D     NPRF+   D   IVCN+  +  WG+E+
Sbjct: 31  DGKKVTIQGFVHSHCTRFAVNFVCFNNDIAFHFNPRFD---DGLVIVCNTMQSSKWGSEE 87

Query: 70  RESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFKIKCVA 126
           R+   PF      E+          + +   Y  ++ +R + ++I  +   GD  +  V 
Sbjct: 88  RKKHMPFSKNGAFEITVLVLGHAFQVSVNGQYILEYRHRTSYQSIQSVQVNGDVTLSQVT 147

Query: 127 F 127
           F
Sbjct: 148 F 148



 Score = 96.6 bits (240), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 26/115 (22%), Positives = 45/115 (39%), Gaps = 4/115 (3%)

Query: 17  LRVRGEVAADAKSFLLNLGKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAEQRESA-FP 75
           + + G V   A  F +NL                    +V N++D G WG E+R  +  P
Sbjct: 225 IIMVGSVGYGADRFHVNLLNSSTRNIYLHIAPRFKEGALVRNTQDRGTWGPEERHMSYMP 284

Query: 76  FQPGSVVEVFNQTD---LTIKLPDGYEFKFPNRLNLEAINYLSAGGDFKIKCVAF 127
           F PG   ++  + +     + +     F + +RL    I+ +   GD  +  V F
Sbjct: 285 FVPGQQFQMEIRNEGGCFGVYVNSAKVFTYVHRLPANQIDMMEVNGDVSLSYVQF 339


>ref|NP_001133778.1| Galectin-8 [Salmo salar]
 gb|ACI33884.1| Galectin-8 [Salmo salar]
          Length = 296

 Score =  132 bits (334), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 31/128 (24%), Positives = 60/128 (46%), Gaps = 14/128 (10%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNLGK--------DDNNLCNPRFNAHGDVNTIVCNSKDA 62
           L+PGE + ++G V +D + F ++           D     NPRF        IVCN+ + 
Sbjct: 25  LQPGEMVLIQGTVPSDCERFQVDFTCGNSTKPRADIAFHFNPRFKRSP---CIVCNTLER 81

Query: 63  GAWGAEQRESAFPFQPGSVVE---VFNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGD 119
            +WG E+      F  GS  E   +  + +  + +   +  ++ +RL+L+ ++ L+  G 
Sbjct: 82  ESWGKEEILYKNAFTLGSTFEMIVLVQKDEFKVAVNGAHVLQYNHRLDLDKVDTLAISGK 141

Query: 120 FKIKCVAF 127
            K++ + F
Sbjct: 142 VKVQAIGF 149



 Score = 98.9 bits (246), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 26/122 (21%), Positives = 49/122 (40%), Gaps = 5/122 (4%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNLGKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAEQR 70
           L  G  + ++G+ +    SFL+NL   +        N        + NS  +  WG E+ 
Sbjct: 174 LSVGHTITIKGQTSLYPHSFLVNLRVGNTEDIALHLNPRMKAAMFIRNSYLSECWGPEEN 233

Query: 71  E-SAFPFQPGSVVEVF---NQTDLTIKLPDGYEFKFPNRL-NLEAINYLSAGGDFKIKCV 125
              +FPF PG   E+          + +   ++  + +R+ +L  I  L   GD ++  +
Sbjct: 234 TLPSFPFSPGEYFEMIILCEAHQFKVAVNGVHQLDYKHRVQDLSRITELEILGDLQLLDI 293

Query: 126 AF 127
             
Sbjct: 294 KL 295


>gb|AAK29385.1|AF331640_1 beta-galactoside-binding protein galectin-7 [Mus musculus]
          Length = 136

 Score =  132 bits (333), Expect = 9e-30,   Method: Composition-based stats.
 Identities = 31/122 (25%), Positives = 55/122 (45%), Gaps = 5/122 (4%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAE 68
           ++ G  +R+RG V   A  F +NL  G++        FN   D + +V N+K+ G WG E
Sbjct: 14  VRVGTVMRIRGMVPDQAGRFHVNLLCGEEQGADAALHFNPRLDTSEVVFNTKEQGKWGRE 73

Query: 69  QRESAFPFQPGSVVE---VFNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFKIKCV 125
           +R +  PF+ G   E   +  +      + D     F +R+    +  +  GGD ++  +
Sbjct: 74  ERGTGIPFERGQPFEVLLIATEEGFKAVVGDDEYLHFHHRMPPARVRLVEVGGDVQLHSL 133

Query: 126 AF 127
             
Sbjct: 134 NI 135


>ref|NP_072104.2| lectin, galactose binding, soluble 7 [Rattus norvegicus]
 sp|P97590|LEG7_RAT RecName: Full=Galectin-7; Short=Gal-7
 gb|EDM07867.1| rCG54103, isoform CRA_a [Rattus norvegicus]
 gb|EDM07868.1| rCG54103, isoform CRA_a [Rattus norvegicus]
          Length = 136

 Score =  132 bits (333), Expect = 9e-30,   Method: Composition-based stats.
 Identities = 34/122 (27%), Positives = 54/122 (44%), Gaps = 5/122 (4%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAE 68
           ++ G  +R+RG V   A  F +NL  G++        FN   D + +V N+K  G WG E
Sbjct: 14  VRLGTVMRIRGVVPDQAGRFHVNLLCGEEQEADAALHFNPRLDTSEVVFNTKQQGKWGRE 73

Query: 69  QRESAFPFQPGSVVEVF---NQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFKIKCV 125
           +R +  PFQ G   EV     +      + D     F +R+    +  +  GGD ++  V
Sbjct: 74  ERGTGIPFQRGQPFEVLIITTEEGFKTVIGDDEYLHFHHRMPSSNVRSVEVGGDVQLHSV 133

Query: 126 AF 127
             
Sbjct: 134 KI 135


>ref|NP_001135709.1| hypothetical protein LOC100216286 [Xenopus (Silurana) tropicalis]
 gb|AAI68834.1| Unknown (protein for MGC:189054) [Xenopus tropicalis]
          Length = 135

 Score =  132 bits (333), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 52/128 (40%), Positives = 75/128 (58%), Gaps = 6/128 (4%)

Query: 4   LVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNN---LCNPRFNAHGDVNTIVCNSK 60
           +  +NL+L  G  + VRG +  D K F +++G D  N    CNPRF    D NTI+ NSK
Sbjct: 7   VTITNLSLHKGHRVEVRGRILKDTKRFAVDMGADAENLIMHCNPRFEFSVDKNTIIFNSK 66

Query: 61  DAGAWGAEQRESAFPFQPGSV-VEVFNQTD-LTIKLPDGYEFKFPNRLNLEAINYLSAGG 118
             G WG EQ+E+AFPFQ GS  + +F   D +T+ LPDG E  F  R  ++ INYL+   
Sbjct: 67  QNGVWGTEQKETAFPFQAGSETMLIFEFEDCITVLLPDGTEVPFTCRFPIDVINYLALY- 125

Query: 119 DFKIKCVA 126
           + ++  ++
Sbjct: 126 NLELISIS 133


>gb|AAB88871.1| galectin-7 [Rattus norvegicus]
          Length = 132

 Score =  132 bits (332), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 34/122 (27%), Positives = 54/122 (44%), Gaps = 5/122 (4%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAE 68
           ++ G  +R+RG V   A  F +NL  G++        FN   D + +V N+K  G WG E
Sbjct: 10  VRLGTVMRIRGVVPDQAGRFHVNLLCGEEQEADAALHFNPRLDTSEVVFNTKQQGKWGRE 69

Query: 69  QRESAFPFQPGSVVEVF---NQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFKIKCV 125
           +R +  PFQ G   EV     +      + D     F +R+    +  +  GGD ++  V
Sbjct: 70  ERGTGIPFQRGQPFEVLIITTEEGFKTVIGDDEYLHFHHRMPSSNVRSVEVGGDVQLHSV 129

Query: 126 AF 127
             
Sbjct: 130 KI 131


>ref|XP_392379.2| PREDICTED: similar to Galectin-4 (Lactose-binding lectin 4) (L-36
           lactose-binding protein) (L36LBP) [Apis mellifera]
          Length = 482

 Score =  132 bits (332), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 36/129 (27%), Positives = 62/129 (48%), Gaps = 15/129 (11%)

Query: 11  LKPGECLRVRGEVAADAKSFLLN--LGK------DDNNLCNPRFNAHGDVNTIVCNSKDA 62
           LKPG+ ++++G+V+ DA  F +N  LG       D     +PRF        I  N  ++
Sbjct: 21  LKPGKMVKIQGKVSPDAIRFAINYQLGPNLNPRDDIAIHVSPRFPEGF----ITRNHIES 76

Query: 63  GAWGAEQRESAFPFQPGSVVEVFNQTD---LTIKLPDGYEFKFPNRLNLEAINYLSAGGD 119
             WG E+ E     QPG   E+    D     I +   +  +F +RL+ + + +L   GD
Sbjct: 77  MTWGIEENEGPMLIQPGQEFEILLLCDHKCYKIAINGRHFTEFNHRLSYDKVTHLVIDGD 136

Query: 120 FKIKCVAFE 128
            +I+ +++E
Sbjct: 137 VEIQSISYE 145


>gb|EDM15848.1| lectin, galactoside-binding, soluble 2, isoform CRA_c [Rattus
           norvegicus]
          Length = 119

 Score =  132 bits (332), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 48/121 (39%), Positives = 67/121 (55%), Gaps = 5/121 (4%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNLGKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAEQR 70
           +K G  L+++G++  D  SF +NLG+    L N  FN   + +TIVCN+ D  +WG EQR
Sbjct: 1   MKSGMSLKIKGKIHNDVNSFTINLGQGKETL-NLHFNPRFNESTIVCNTLDGSSWGQEQR 59

Query: 71  ESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFKIKCVAF 127
           E+   F PGS V++   F   D  + LPDG+   FPNRL    + YLS  G  +I     
Sbjct: 60  ENHSCFSPGSEVKLTLTFQDKDFKVTLPDGHSLTFPNRLGHNHLRYLSMDG-LQISSFKL 118

Query: 128 E 128
           E
Sbjct: 119 E 119


>pdb|2NMN|A Chain A, Crystal Structure Of Human Galectin-3 Carbohydrate-
           Recognising Domain At 2.45 Angstrom Resolution
 pdb|2NMO|A Chain A, Crystal Structure Of Human Galectin-3 Carbohydrate-
           Recognition Domain At 1.35 Angstrom Resolution
 pdb|2NN8|A Chain A, Crystal Structure Of Human Galectin-3 Carbohydrate-
           Recognition Domain With Lactose Bound, At 1.35 Angstrom
           Resolution
          Length = 138

 Score =  131 bits (331), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 37/134 (27%), Positives = 61/134 (45%), Gaps = 11/134 (8%)

Query: 4   LVASNLNL----KPGECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVC 57
           +V  NL L     P   + + G V  +A    L+   G D     NPRFN + +   IVC
Sbjct: 3   IVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNEN-NRRVIVC 61

Query: 58  NSKDAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRL-NLEAINY 113
           N+K    WG E+R+S FPF+ G   ++          + + D +  ++ +R+  L  I+ 
Sbjct: 62  NTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISK 121

Query: 114 LSAGGDFKIKCVAF 127
           L   GD  +   ++
Sbjct: 122 LGISGDIDLTSASY 135


>ref|NP_496165.3| gaLECtin family member (lec-2) [Caenorhabditis elegans]
 emb|CAA91327.2| C. elegans protein F52H3.7a, confirmed by transcript evidence
            [Caenorhabditis elegans]
          Length = 1245

 Score =  131 bits (331), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 39/118 (33%), Positives = 58/118 (49%), Gaps = 4/118 (3%)

Query: 11   LKPGECLRVRGEVAADAKSFLLNLGKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAEQR 70
            L PG+ L V G     AK F +NL K + ++     NA  D   +V NS    AWG E+R
Sbjct: 1126 LAPGKTLTVFGIPEKKAKRFHINLLKKNGDIA-LHLNARFDEKHVVRNSLINSAWGNEER 1184

Query: 71   ESAFPFQP--GSVVEVFNQTDLTIKLPDGYEF-KFPNRLNLEAINYLSAGGDFKIKCV 125
            E   PF+   G  +E+ N+        +G  F  + +RL+ + +N L  GGD +I  +
Sbjct: 1185 EGKMPFEKAVGFDLEIHNEPYAFAVTVNGERFASYAHRLSPDEVNGLQIGGDVEITGI 1242



 Score =  112 bits (282), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 30/129 (23%), Positives = 59/129 (45%), Gaps = 16/129 (12%)

Query: 10   NLKPGECLRVRGEVAADAKSFLLNL--------GKDDNNLCNPRFNAHGDVNTIVCNSKD 61
              +PG+ L V+G+   D+  F +NL        G D     + RF    D   +V N+  
Sbjct: 985  PFEPGQTLIVKGKTGEDSIRFTVNLHTNTADFSGNDVPLHVSVRF----DEGKLVFNTFS 1040

Query: 62   AGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGG 118
             G WG E+R+S  P++ G  +++    + +   I +      ++ +R+ L +I + +  G
Sbjct: 1041 KGEWGKEERKSN-PYKKGDDIDIRIRAHDSKFQIFVDQKEVKEYEHRVPLSSITHFTIDG 1099

Query: 119  DFKIKCVAF 127
            D  +  + +
Sbjct: 1100 DVLVNYIHW 1108


>ref|XP_001376472.1| PREDICTED: similar to S-lac lectin [Monodelphis domestica]
          Length = 142

 Score =  131 bits (331), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 40/128 (31%), Positives = 68/128 (53%), Gaps = 4/128 (3%)

Query: 4   LVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNLCNPRFNAHGDVNTIVCNSKDAG 63
           +   +++LK G  L+++G++  DA  F++NLG+   NL +  FN      TIVCNS++ G
Sbjct: 16  VEIHHMDLKQGMTLKLKGKINDDANGFVINLGQSPGNL-DLHFNPRFGEKTIVCNSQNGG 74

Query: 64  AWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDF 120
            W  E R+    F PG+ +++     + +  +KLPDG++ KFPNR     + Y    G  
Sbjct: 75  RWEQEHRDDHVCFSPGTEIKLTVTLEEDEFQVKLPDGHQVKFPNRRKCSHLPYCCVEGGI 134

Query: 121 KIKCVAFE 128
            +     +
Sbjct: 135 SLTSFKLD 142


>ref|XP_002248728.1| hypothetical protein BRAFLDRAFT_289597 [Branchiostoma floridae]
 gb|EEA31772.1| hypothetical protein BRAFLDRAFT_289597 [Branchiostoma floridae]
          Length = 313

 Score =  131 bits (331), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 33/130 (25%), Positives = 56/130 (43%), Gaps = 16/130 (12%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNLGK--------DDNNLCNPRFNAHGDVNTIVCNSKDA 62
           L+PG+ + ++G V   A  F +NL          D     NPR  A      +V N    
Sbjct: 28  LQPGKMITIQGFVIPGADRFHVNLQCGASTQPRADIAMHFNPRLMA----GVVVRNCLQN 83

Query: 63  GAWGAEQR-ESAFPFQPGSVVEVF---NQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGG 118
            AWGAE++    FPF  G   E+          + +   +  +F +R+  + +N L+  G
Sbjct: 84  QAWGAEEKPHGPFPFAMGQNFEMIILTEPDKFKVAVNGQHFIEFRHRIPFQRVNTLAIDG 143

Query: 119 DFKIKCVAFE 128
             +I+ + F+
Sbjct: 144 KVQIQAIRFD 153



 Score =  118 bits (297), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 34/131 (25%), Positives = 55/131 (41%), Gaps = 18/131 (13%)

Query: 11  LKPGECLRVRGEVAAD-AKSFLLNLGK--------DDNNLCNPRFNAHGDVNTIVCNSKD 61
           L PG+ + + G V       F  NL          D     NPRF A      +V NS  
Sbjct: 186 LYPGKMVIINGTVHPGMPDRFHFNLQCGASTAPRADIAMQFNPRFAA----RAVVRNSLT 241

Query: 62  AGAWGAEQRESA-FPFQPGSVVE---VFNQTDLTIKLPDGYEFKFPNRL-NLEAINYLSA 116
             +WGAE++++  FPF PG   E   +  Q    + +   +  +F +R+  L  ++ L  
Sbjct: 242 NNSWGAEEKDTPYFPFMPGQPFELMVLCQQDSFKVAVNGQHLTEFRHRIQPLTRVDTLVV 301

Query: 117 GGDFKIKCVAF 127
            G   ++ + F
Sbjct: 302 EGKVSLQQIRF 312


>ref|XP_002230376.1| hypothetical protein BRAFLDRAFT_126856 [Branchiostoma floridae]
 gb|EEA50195.1| hypothetical protein BRAFLDRAFT_126856 [Branchiostoma floridae]
          Length = 313

 Score =  131 bits (331), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 33/130 (25%), Positives = 56/130 (43%), Gaps = 16/130 (12%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNLGK--------DDNNLCNPRFNAHGDVNTIVCNSKDA 62
           L+PG+ + ++G V   A  F +NL          D     NPR  A      +V N    
Sbjct: 28  LQPGKMITIQGFVIPGADRFHVNLQCGASTQPRADIAMHFNPRLMA----GVVVRNCLQN 83

Query: 63  GAWGAEQR-ESAFPFQPGSVVEVF---NQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGG 118
            AWGAE++    FPF  G   E+          + +   +  +F +R+  + +N L+  G
Sbjct: 84  QAWGAEEKPHGPFPFAMGQNFEMIILTEPDKFKVAVNGQHFIEFRHRIPFQRVNTLAIDG 143

Query: 119 DFKIKCVAFE 128
             +I+ + F+
Sbjct: 144 KVQIQAIRFD 153



 Score =  118 bits (297), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 34/131 (25%), Positives = 54/131 (41%), Gaps = 18/131 (13%)

Query: 11  LKPGECLRVRGEVAAD-AKSFLLNLGK--------DDNNLCNPRFNAHGDVNTIVCNSKD 61
           L PG+ + + G V       F  NL          D     NPRF A      +V NS  
Sbjct: 186 LYPGKMVIINGTVHPGMPDRFHFNLQCGASTAPRADIAMQFNPRFAA----RAVVRNSLT 241

Query: 62  AGAWGAEQRESA-FPFQPGSVVE---VFNQTDLTIKLPDGYEFKFPNRL-NLEAINYLSA 116
              WGAE++++  FPF PG   E   +  Q    + +   +  +F +R+  L  ++ L  
Sbjct: 242 NNKWGAEEKDTPYFPFMPGQPFELMVLCQQDSFKVAVNGQHLTEFRHRIQPLTRVDTLVV 301

Query: 117 GGDFKIKCVAF 127
            G   ++ + F
Sbjct: 302 EGKVSLQQIRF 312


>ref|XP_001156867.1| PREDICTED: hypothetical protein isoform 4 [Pan troglodytes]
          Length = 358

 Score =  131 bits (331), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 25/108 (23%), Positives = 49/108 (45%), Gaps = 11/108 (10%)

Query: 29  SFLLNL-----GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAEQRESAFPFQPGSVVE 83
            F ++      G D     NPRF    D   +VCN++  G WG E+R+   PFQ G   +
Sbjct: 47  RFAVDFQTGFSGNDIAFHFNPRFE---DGGYVVCNTRQKGRWGPEERKMHMPFQKGMPFD 103

Query: 84  ---VFNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFKIKCVAFE 128
              +   +D  + +      ++ +R+    ++ +S  G  ++  ++F+
Sbjct: 104 LCFLVQSSDFKVMVNGSLFVQYFHRVPFHRVDTISVNGSVQLSYISFQ 151



 Score =  120 bits (303), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 37/123 (30%), Positives = 57/123 (46%), Gaps = 12/123 (9%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAE 68
           L P + + + G V   A+ F +NL  G       NPRF    D N +V N++   +WG+E
Sbjct: 238 LYPSKSIILSGTVLPSAQRFHINLCSGSHIAFHMNPRF----DENAVVRNTQINNSWGSE 293

Query: 69  QRE--SAFPFQPGSVV---EVFNQTDLTIKLPDGYEFKFPNRL-NLEAINYLSAGGDFKI 122
           +R      PF  G       +     L + +   + F++ +RL NL  IN L  GGD ++
Sbjct: 294 ERSLPRKMPFVRGQSFSVWILCEAHCLKVAVDGQHVFEYYHRLRNLPTINKLEVGGDIQL 353

Query: 123 KCV 125
             V
Sbjct: 354 THV 356


>pdb|1A3K|A Chain A, X-Ray Crystal Structure Of The Human Galectin-3
           Carbohydrate Recognition Domain (Crd) At 2.1 Angstrom
           Resolution
          Length = 137

 Score =  131 bits (331), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 37/134 (27%), Positives = 61/134 (45%), Gaps = 11/134 (8%)

Query: 4   LVASNLNL----KPGECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVC 57
           +V  NL L     P   + + G V  +A    L+   G D     NPRFN + +   IVC
Sbjct: 2   IVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNEN-NRRVIVC 60

Query: 58  NSKDAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRL-NLEAINY 113
           N+K    WG E+R+S FPF+ G   ++          + + D +  ++ +R+  L  I+ 
Sbjct: 61  NTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISK 120

Query: 114 LSAGGDFKIKCVAF 127
           L   GD  +   ++
Sbjct: 121 LGISGDIDLTSASY 134


>gb|AAH56859.1| Xgalectin-iva protein [Xenopus laevis]
          Length = 353

 Score =  131 bits (330), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 28/119 (23%), Positives = 51/119 (42%), Gaps = 9/119 (7%)

Query: 15  ECLRVRGEVAADAKSFLLNL---GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAEQRE 71
           + + ++G V +    F +N      D     NPRF+   D   IVCN+  +  WG+E+R+
Sbjct: 47  KKVTIQGFVHSHCTRFAVNFVCFNNDIAFHFNPRFD---DGLVIVCNTMQSSKWGSEERK 103

Query: 72  SAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFKIKCVAF 127
              PF      E+          + +   Y  ++ +R + ++I  +   GD  +  V F
Sbjct: 104 KHMPFSKNGAFEITVLVLGHAFQVSVNGQYILEYRHRTSYQSIQSVQVNGDVTLSQVTF 162



 Score = 97.4 bits (242), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 26/115 (22%), Positives = 45/115 (39%), Gaps = 4/115 (3%)

Query: 17  LRVRGEVAADAKSFLLNLGKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAEQRESA-FP 75
           + + G V   A  F +NL                    +V N++D G WG E+R  +  P
Sbjct: 239 IIMVGSVGYGADRFHVNLLNSSTRNIYLHIAPRFKEGALVRNTQDRGTWGPEERHMSYMP 298

Query: 76  FQPGSVVEVFNQTD---LTIKLPDGYEFKFPNRLNLEAINYLSAGGDFKIKCVAF 127
           F PG   ++  + +     + +     F + +RL    I+ +   GD  +  V F
Sbjct: 299 FVPGQQFQMEIRNEGGCFGVYVNSAKVFTYVHRLPANQIDMMEVNGDVSLSYVQF 353


>gb|EDL20743.1| lectin, galactose binding, soluble 3, isoform CRA_b [Mus musculus]
          Length = 124

 Score =  130 bits (329), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 35/120 (29%), Positives = 57/120 (47%), Gaps = 7/120 (5%)

Query: 13  PGECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAEQR 70
           P   + + G V  +A   +L+   G D     NPRFN + +   IVCN+K    WG E+R
Sbjct: 2   PRMLITIMGTVKPNANRIVLDFRRGNDVAFHFNPRFNEN-NRRVIVCNTKQDNNWGKEER 60

Query: 71  ESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRL-NLEAINYLSAGGDFKIKCVA 126
           +SAFPF+ G   ++          + + D +  ++ +R+ NL  I+ L   GD  +    
Sbjct: 61  QSAFPFESGKPFKIQVLVEADHFKVAVNDAHLLQYNHRMKNLREISQLGISGDITLTSAN 120


>gb|AAA41378.1| IgE binding protein
          Length = 138

 Score =  130 bits (329), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 39/132 (29%), Positives = 62/132 (46%), Gaps = 11/132 (8%)

Query: 5   VASNLNL----KPGECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVCN 58
           V  ++ L     P   + + G V  +A S  LN   G D     NPRFN + +   IVCN
Sbjct: 4   VPYDMPLPGGVMPRMLITIIGTVKPNANSITLNFKKGNDIAFHFNPRFNEN-NRRVIVCN 62

Query: 59  SKDAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRL-NLEAINYL 114
           +K    WG E+R+SAFPF+ G   ++          + + D +  ++ +R+ NL  I+ L
Sbjct: 63  TKQDNNWGREERQSAFPFESGKPFKIQVLVEADHFKVAVNDVHLLQYNHRMKNLREISQL 122

Query: 115 SAGGDFKIKCVA 126
              GD  +   +
Sbjct: 123 GIIGDITLTSAS 134


>gb|AAI06496.1| LOC733366 protein [Xenopus laevis]
          Length = 445

 Score =  130 bits (329), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 29/123 (23%), Positives = 60/123 (48%), Gaps = 9/123 (7%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNLGKDDNNLC---NPRFNAHGDVNTIVCNSKDAGAWGA 67
           +  G+ + + G + +D K F ++    +N++    NPRF+   D  TIVCN+K +  WG+
Sbjct: 323 ISDGKTVTIEGLIHSDCKRFTVDFLCFNNDIAFQLNPRFD---DGKTIVCNTKLSNKWGS 379

Query: 68  EQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFKIKC 124
            ++ +  PF      E+     +    + +   +  ++ +R++ +AI  L   G+  +  
Sbjct: 380 AEKMNPMPFSKDEAFEITIAVLEHVFQVSVNGEHILEYRHRVSYQAIKSLYVNGNITLTN 439

Query: 125 VAF 127
           V F
Sbjct: 440 VNF 442



 Score =  114 bits (287), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 33/123 (26%), Positives = 51/123 (41%), Gaps = 9/123 (7%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNLG---KDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGA 67
           +  G+ + + G V +D   F +N     KD     NPRF+     NTIVCN+K    WG 
Sbjct: 172 INDGKTVTIEGLVHSDCNRFAVNFLCFNKDIAFHFNPRFDQ---DNTIVCNTKLEDKWGT 228

Query: 68  EQRESAFPFQPGSVVE---VFNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFKIKC 124
            +R    PF      E   V  +    + +       + +R++ + I  L   GD  +  
Sbjct: 229 VERTQLMPFDKDDSFELSIVILEHVFQVSVNRKRILDYHHRVSYQGIQSLLVNGDITLLN 288

Query: 125 VAF 127
           V F
Sbjct: 289 VTF 291



 Score =  110 bits (277), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 29/121 (23%), Positives = 47/121 (38%), Gaps = 10/121 (8%)

Query: 13  PGECLRVRGEVAADAKSFLLNLG---KDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAEQ 69
            G+ + + G V  D K F +N      D     NPRF    D + I CN+K    WG E+
Sbjct: 23  EGKKVTLEGLVHNDCKRFSVNFLCFNNDTAFHFNPRF----DKDNIACNTKLNSQWGLEE 78

Query: 70  RESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFKIKCVA 126
                 F      E+     +    I + +    ++ +R+  + I  +   GD  +  V 
Sbjct: 79  ITDHMLFSHNDSFEITITVMRGTFQISVNNDQILEYRHRIAYQGIQSIQVNGDITLNKVT 138

Query: 127 F 127
           F
Sbjct: 139 F 139


>ref|NP_001082204.1| galectin family xgalectin-IIa [Xenopus laevis]
 dbj|BAB83257.1| galectin family xgalectin-IIa [Xenopus laevis]
 gb|AAH75170.1| Xgalectin-IIa protein [Xenopus laevis]
          Length = 340

 Score =  130 bits (329), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 35/125 (28%), Positives = 61/125 (48%), Gaps = 13/125 (10%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL------GKDDNNLCNPRFNAHGDVNTIVCNSKDAGA 64
           L+ G  + V+G +  +   F +N       G D     NPRF+     + +V NS   G+
Sbjct: 27  LRAGMSVYVQGTIPNNITRFAVNFTCGQHDGADVACHFNPRFDG---KDKVVFNSMIGGS 83

Query: 65  WGAEQRES-AFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDF 120
           WG+E+++  +FPF+ G   E+    N +   I +     +KF +R+ LE +N L   GD 
Sbjct: 84  WGSEEKKKDSFPFRKGKSFELAFMINSSSFEITVNGSSFYKFKHRMPLERVNSLQVSGDV 143

Query: 121 KIKCV 125
            ++ +
Sbjct: 144 SVQAL 148



 Score =  117 bits (293), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 31/122 (25%), Positives = 58/122 (47%), Gaps = 5/122 (4%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNLGKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAEQR 70
           + P + + +RG +   A+ F +N     +N     FN     N++V NS+  G+WG E+R
Sbjct: 219 MSPRKTVIIRGFIPEGAERFHINFKAGSSNDVALHFNPRLTENSVVRNSRLGGSWGQEER 278

Query: 71  E-SAFPFQPGSVVEVFNQTD---LTIKLPDGYEFKFPNRLN-LEAINYLSAGGDFKIKCV 125
           + S  PF+PG   ++  +      T+ +       F +R + L+ I+ +   G+  I  +
Sbjct: 279 QLSYNPFRPGQYFDISLRCGMDRFTVFVNGQQFCDFAHRYSMLQMIDRIEIEGNVVISLI 338

Query: 126 AF 127
            F
Sbjct: 339 QF 340


>sp|Q29373|LEG2_PIG RecName: Full=Galectin-2
          Length = 123

 Score =  130 bits (328), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 46/120 (38%), Positives = 68/120 (56%), Gaps = 4/120 (3%)

Query: 4   LVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNLCNPRFNAHGDVNTIVCNSKDAG 63
           +   N+++K G+ L+++G+   DA  F +NLG+  + L    F      +TIVCN +D  
Sbjct: 5   VEIMNMDMKVGKTLKIKGKXDDDADGFXINLGQGTDKLA-LHFXPRFGESTIVCNXRDGN 63

Query: 64  AWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDF 120
            WG EQR+S   F PGS V++   F +    +KLPDG++  FPNRL    + YLS  G F
Sbjct: 64  XWGKEQRDSHMXFXPGSEVKLIVTFEEDGFKVKLPDGHQLTFPNRLGYSHLRYLSVQGGF 123


>gb|EDL88351.1| lectin, galactose binding, soluble 3, isoform CRA_b [Rattus
           norvegicus]
          Length = 142

 Score =  130 bits (328), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 39/132 (29%), Positives = 62/132 (46%), Gaps = 11/132 (8%)

Query: 5   VASNLNL----KPGECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVCN 58
           V  ++ L     P   + + G V  +A S  LN   G D     NPRFN + +   IVCN
Sbjct: 8   VPYDMPLPGGVMPRMLITIIGTVKPNANSITLNFKKGNDIAFHFNPRFNEN-NRRVIVCN 66

Query: 59  SKDAGAWGAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRL-NLEAINYL 114
           +K    WG E+R+SAFPF+ G   ++          + + D +  ++ +R+ NL  I+ L
Sbjct: 67  TKQDNNWGREERQSAFPFESGKPFKIQVLVEADHFKVAVNDVHLLQYNHRMKNLREISQL 126

Query: 115 SAGGDFKIKCVA 126
              GD  +   +
Sbjct: 127 GIIGDITLTSAS 138


>gb|ACI69049.1| Galectin-2 [Salmo salar]
          Length = 129

 Score =  130 bits (328), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 43/126 (34%), Positives = 61/126 (48%), Gaps = 4/126 (3%)

Query: 6   ASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNLCNPRFNAHGDVNTIVCNSKDAGAW 65
              ++ K G+ +   G+  + A SF +N+G D +N     FN       IVCNS   G+W
Sbjct: 5   VEEMSFKQGQEMTFTGKTKSGASSFSINIGHDSDNYA-LHFNPRFTHGQIVCNSLSGGSW 63

Query: 66  GAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFKI 122
           G E +E  FPFQ G   ++   F      IKLPDG+   FPNRL     N++   GD K+
Sbjct: 64  GDEFKEGHFPFQDGEQFKLVLNFTNEQFYIKLPDGHMMDFPNRLGDCKYNHIMVDGDVKV 123

Query: 123 KCVAFE 128
                +
Sbjct: 124 ISFKVK 129


>gb|AAH93113.1| Lgals3l protein [Danio rerio]
          Length = 249

 Score =  130 bits (328), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 43/135 (31%), Positives = 59/135 (43%), Gaps = 12/135 (8%)

Query: 5   VASNLNLKPG----ECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVCN 58
           V  +  L+ G      + + GEV  +AK F +NL  G D     NPRF+  G    IV N
Sbjct: 113 VPLDFPLQNGAYNKMLITINGEVKPNAKQFTVNLRRGNDIAFHINPRFSEGG-KPVIVRN 171

Query: 59  SKDAGAWGAEQRE-SAFPFQPGSVVE---VFNQTDLTIKLPDGYEFKFPNR-LNLEAINY 113
           S     WG E+RE   FPF PG   E   +   T+  + +   +  +F +R   L  I  
Sbjct: 172 SMIGNNWGREERELPPFPFVPGKPFEMKILITDTEYKVAVNKSHLLEFKHRVFELNQITG 231

Query: 114 LSAGGDFKIKCVAFE 128
           LS   D  +  V  E
Sbjct: 232 LSIYNDVTLSTVNVE 246


>ref|XP_001788803.1| PREDICTED: similar to galectin-14 [Bos taurus]
          Length = 516

 Score =  130 bits (327), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 32/127 (25%), Positives = 55/127 (43%), Gaps = 12/127 (9%)

Query: 11  LKPGECLRVRGEVAA-DAKSFLLNLGKD-----DNNLCNPRFNAHGDVNTIVCNSKDAGA 64
           L+ G  + V G V +     F +N   D          NPRF        +VCN+K  G 
Sbjct: 69  LQDGHKITVMGRVLSTGESRFSVNFQMDHTDHEIAFHFNPRFEEG---RYVVCNTKQLGK 125

Query: 65  WGAEQRESAFPFQPGSVVEVFNQTD---LTIKLPDGYEFKFPNRLNLEAINYLSAGGDFK 121
           WG E+R+   PFQ GS+ E+  + +     + +       + +R+    +N +S  G   
Sbjct: 126 WGPEERKMQMPFQKGSLFEICFEVESSAFKVMVNKNIFLYYVHRVPFYQLNAISVKGGVH 185

Query: 122 IKCVAFE 128
           +  ++F+
Sbjct: 186 LSYISFQ 192



 Score =  108 bits (270), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 23/110 (20%), Positives = 48/110 (43%), Gaps = 11/110 (10%)

Query: 27  AKSFLLNLG------KDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAEQRESAFPFQPGS 80
           +  F +N         +     NPRF    D   +VCN++   +WG E+R+    FQ G 
Sbjct: 331 SSRFEVNFQIAFSDINNIAFHFNPRFE---DNGYVVCNTRQNRSWGPEERKMQMSFQRGI 387

Query: 81  VVEVFNQTD--LTIKLPDGYEFKFPNRLNLEAINYLSAGGDFKIKCVAFE 128
             E+  Q +    + +      ++ + + L ++N ++  G   +  ++F+
Sbjct: 388 HFELCFQVESWFKVMVNGNLFTQYAHCMPLHSVNTITVAGLVNVSKISFQ 437



 Score = 45.8 bits (108), Expect = 0.001,   Method: Composition-based stats.
 Identities = 11/45 (24%), Positives = 19/45 (42%), Gaps = 1/45 (2%)

Query: 36  KDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAEQRESAFPFQPGS 80
            D       +F      + ++CN++  G WG E++    PFQ   
Sbjct: 473 NDIAFYFCAQFED-DSSDYVICNTRQEGKWGTEEKICEMPFQRRE 516



 Score = 37.7 bits (87), Expect = 0.33,   Method: Composition-based stats.
 Identities = 15/62 (24%), Positives = 21/62 (33%), Gaps = 10/62 (16%)

Query: 11  LKPGECLR-VRGEVAADAK-SFLLNLG-----KDDNNLCNPRFNAHGDVNTIVCNSKDAG 63
           L  G  L  V+G +       F  N        D     +PR     +   +VCN K   
Sbjct: 246 LTSGHMLVLVQGFLGTGPHGRFAANFQTRCSDSDIAFHFSPRLE---NTAYVVCNGKQKR 302

Query: 64  AW 65
           +W
Sbjct: 303 SW 304


>ref|XP_001370559.1| PREDICTED: similar to hCG22119, [Monodelphis domestica]
          Length = 252

 Score =  130 bits (327), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 33/122 (27%), Positives = 52/122 (42%), Gaps = 7/122 (5%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAE 68
           + P   + + G    +A    L+   G D     NPRFN   +   IVCNSK    WG E
Sbjct: 128 IMPRMLITILGTTKPNANKIALDFKKGNDVAFHFNPRFNE-DNRRVIVCNSKFDNNWGKE 186

Query: 69  QRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRL-NLEAINYLSAGGDFKIKC 124
           +R   FPF+ G   ++          + + D +  ++ +R+ NL  I  L   GD  +  
Sbjct: 187 ERHHMFPFEAGKPFKIQVLVETDHFKVAVNDAHLLQYNHRMKNLNEITKLGISGDVNLTS 246

Query: 125 VA 126
            +
Sbjct: 247 TS 248


>ref|XP_001519384.1| PREDICTED: similar to galectin-7 [Ornithorhynchus anatinus]
          Length = 241

 Score =  130 bits (327), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 32/122 (26%), Positives = 55/122 (45%), Gaps = 5/122 (4%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAE 68
           L+PG  +R+RG V  +A  F +N   G++        FN   D   +V NS + G+W  E
Sbjct: 119 LRPGSVVRLRGVVPQEAARFHVNFLCGEEAGADTALHFNPRMDTGEVVFNSFEGGSWKKE 178

Query: 69  QRESAFPFQPGSVVEVFN---QTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFKIKCV 125
           +R    PF+ G   ++          + + D    +F +R+  + +  L  GGD  ++ V
Sbjct: 179 ERGRGLPFRRGEPFDLLLIAADDGYKVVIGDAEYHRFAHRVPPQRVRGLEVGGDVLLQAV 238

Query: 126 AF 127
             
Sbjct: 239 RI 240


>gb|ACI68076.1| Galectin-2 [Salmo salar]
 gb|ACN09900.1| Galectin-2 [Salmo salar]
 gb|ACN12247.1| Galectin-2 [Salmo salar]
          Length = 129

 Score =  130 bits (327), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 43/126 (34%), Positives = 61/126 (48%), Gaps = 4/126 (3%)

Query: 6   ASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNLCNPRFNAHGDVNTIVCNSKDAGAW 65
              ++ K G+ +   G+  + A SF +N+G D +N     FN       IVCNS   G+W
Sbjct: 5   VEEMSFKQGQEMTFTGKTKSGASSFSINIGHDSDNYA-LHFNPRFSHEHIVCNSLSGGSW 63

Query: 66  GAEQRESAFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFKI 122
           G E +E  FPFQ G   ++   F      IKLPDG+   FPNRL     N++   GD K+
Sbjct: 64  GDELKEGHFPFQDGEQFKLVLNFTNEQFYIKLPDGHMMDFPNRLGDCKYNHIMVDGDVKV 123

Query: 123 KCVAFE 128
                +
Sbjct: 124 ISFKVK 129


>ref|NP_001010843.1| lectin, galactoside-binding, soluble, 8 (galectin 8) [Gallus
           gallus]
 gb|AAW51134.1| galectin-8 variant II [Gallus gallus]
          Length = 315

 Score =  130 bits (327), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 36/128 (28%), Positives = 55/128 (42%), Gaps = 14/128 (10%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNLGK--------DDNNLCNPRFNAHGDVNTIVCNSKDA 62
           L PGE + + G V  DA  F ++L          D     NPRF   G    +VCN+ + 
Sbjct: 26  LVPGELIVLHGSVPDDADRFQVDLQCGSSIKPRADVAFHFNPRFKWSG---CVVCNTLER 82

Query: 63  GAWGAEQRESAFPFQPGSVVEVFNQ---TDLTIKLPDGYEFKFPNRLNLEAINYLSAGGD 119
             WG E+     PFQ G   E+          + +   +   + +R++LE I+ L   G 
Sbjct: 83  EKWGWEEITYEMPFQKGRPFEIVIMILKDKFQVSVNKKHLLLYNHRISLERIDTLGIYGK 142

Query: 120 FKIKCVAF 127
            +IK + F
Sbjct: 143 VQIKSIEF 150



 Score =  125 bits (316), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 35/117 (29%), Positives = 54/117 (46%), Gaps = 5/117 (4%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNLGKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAEQR 70
           L PG  + ++GEV  + KSF +NL   D+       N        V NS    +WG E++
Sbjct: 193 LHPGCTVAIKGEVNKNPKSFTINLKSSDSKDIALHLNPRLKNKVFVRNSYLHDSWGEEEK 252

Query: 71  E-SAFPFQPGSVVEVFNQTD---LTIKLPDGYEFKFPNRLN-LEAINYLSAGGDFKI 122
           E + FPF PG   E+    D     + +   +  ++ +R   LE IN L   GD ++
Sbjct: 253 EVTNFPFSPGMYFELIIFCDAHQFKVAVNGVHTLEYKHRFKQLEKINLLEVTGDVQL 309


>emb|CAG32015.1| hypothetical protein [Gallus gallus]
          Length = 296

 Score =  130 bits (327), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 36/128 (28%), Positives = 55/128 (42%), Gaps = 14/128 (10%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNLGK--------DDNNLCNPRFNAHGDVNTIVCNSKDA 62
           L PGE + + G V  DA  F ++L          D     NPRF   G    +VCN+ + 
Sbjct: 26  LVPGELIVLHGSVPDDADRFQVDLQCGSSIKPRADVAFHFNPRFKWSG---CVVCNTLER 82

Query: 63  GAWGAEQRESAFPFQPGSVVEVFNQ---TDLTIKLPDGYEFKFPNRLNLEAINYLSAGGD 119
             WG E+     PFQ G   E+          + +   +   + +R++LE I+ L   G 
Sbjct: 83  EKWGWEEITYEMPFQKGRPFEIVIMILKDKFQVSVNKKHLLLYNHRISLERIDTLGIYGK 142

Query: 120 FKIKCVAF 127
            +IK + F
Sbjct: 143 VQIKSIEF 150



 Score =  125 bits (316), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 35/117 (29%), Positives = 54/117 (46%), Gaps = 5/117 (4%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNLGKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAEQR 70
           L PG  + ++GEV  + KSF +NL   D+       N        V NS    +WG E++
Sbjct: 174 LHPGCTVAIKGEVNKNPKSFTINLKSSDSKDIALHLNPRLKNKVFVRNSYLHDSWGEEEK 233

Query: 71  E-SAFPFQPGSVVEVFNQTD---LTIKLPDGYEFKFPNRLN-LEAINYLSAGGDFKI 122
           E + FPF PG   E+    D     + +   +  ++ +R   LE IN L   GD ++
Sbjct: 234 EVTNFPFSPGMYFELIIFCDAHQFKVAVNGVHTLEYKHRFKQLEKINLLEVTGDVQL 290


>ref|NP_001011449.1| lectin, galactoside-binding, soluble, 4 (galectin 4) [Xenopus
           (Silurana) tropicalis]
 gb|AAH88541.1| Lectin, galactoside-binding, soluble, 4 (galectin 4) [Xenopus
           tropicalis]
          Length = 327

 Score =  130 bits (327), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 34/125 (27%), Positives = 61/125 (48%), Gaps = 13/125 (10%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL------GKDDNNLCNPRFNAHGDVNTIVCNSKDAGA 64
           L+ G  + ++G +      F +N       G D     NPRF+     + +V NS   G+
Sbjct: 27  LRAGMSVYIQGTIPNHITRFAVNFTCGQFDGSDIACHFNPRFDG---KDKVVFNSLIGGS 83

Query: 65  WGAEQRES-AFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDF 120
           WG+E+++  +FPF+ G   ++    NQ+   I +     +KF +R+ LE +N L   GD 
Sbjct: 84  WGSEEKKKDSFPFRKGKSFDLAFMINQSAFEITVNGSSFYKFKHRMPLERVNSLQVSGDV 143

Query: 121 KIKCV 125
            ++ +
Sbjct: 144 TVQSL 148



 Score =  114 bits (287), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 28/120 (23%), Positives = 55/120 (45%), Gaps = 5/120 (4%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNLGKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAEQR 70
           + P + + +RG +   A+ F +N     +N     FN     N +V NS+  G+WG E+R
Sbjct: 206 MSPRKTVIIRGFIPEGAERFHINFKAGSSNDVALHFNPRLTENVVVRNSRLGGSWGQEER 265

Query: 71  E-SAFPFQPGSVVEVFNQTD---LTIKLPDGYEFKFPNRLN-LEAINYLSAGGDFKIKCV 125
             S  PF+PG   ++  +      T+ +   +   F +R +  + ++ +   G+  +  V
Sbjct: 266 NLSYNPFRPGQYFDISIRCGMDRFTVFVNGQHFCDFAHRYSMFQMLDRIEVEGNVVLSLV 325


>ref|NP_999858.2| chimera galectin Gal3 [Danio rerio]
 gb|AAI07991.1| Lectin, galactoside-binding, soluble, 3 (galectin 3)-like [Danio
           rerio]
          Length = 228

 Score =  129 bits (326), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 43/135 (31%), Positives = 60/135 (44%), Gaps = 12/135 (8%)

Query: 5   VASNLNLKPG----ECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVCN 58
           V  +  L+ G      + + GEV  +AK F +NL  G D     NPRF+  G    IV N
Sbjct: 92  VPLDFPLQNGAYNKMLITINGEVKPNAKQFTVNLRRGNDIAFHINPRFSEGG-KPVIVRN 150

Query: 59  SKDAGAWGAEQRE-SAFPFQPGSVVE---VFNQTDLTIKLPDGYEFKFPNR-LNLEAINY 113
           S     WG E+RE  +FPF PG   E   +   T+  + +   +  +F +R   L  I  
Sbjct: 151 SMIGNNWGREERELPSFPFVPGKPFEMKILITDTEYKVAVNKSHLLEFKHRVFELNQITG 210

Query: 114 LSAGGDFKIKCVAFE 128
           LS   D  +  V  E
Sbjct: 211 LSIYNDVTLSTVNVE 225


>gb|AAR84191.1| chimera galectin Gal3 [Danio rerio]
          Length = 228

 Score =  129 bits (326), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 43/135 (31%), Positives = 60/135 (44%), Gaps = 12/135 (8%)

Query: 5   VASNLNLKPG----ECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVCN 58
           V  +  L+ G      + + GEV  +AK F +NL  G D     NPRF+  G    IV N
Sbjct: 92  VPLDFPLQNGAYNKMLITINGEVKPNAKQFTVNLRRGNDIAFHINPRFSEGG-KPVIVRN 150

Query: 59  SKDAGAWGAEQRE-SAFPFQPGSVVE---VFNQTDLTIKLPDGYEFKFPNR-LNLEAINY 113
           S     WG E+RE  +FPF PG   E   +   T+  + +   +  +F +R   L  I  
Sbjct: 151 SMIGNNWGREERELPSFPFVPGKPFEMKILITDTEYKVAVNKSHLLEFKHRVFELNQITG 210

Query: 114 LSAGGDFKIKCVAFE 128
           LS   D  +  V  E
Sbjct: 211 LSIYNDVTLSTVNVE 225


>gb|ABD97855.1| galectin 8 variant I [Gallus gallus]
          Length = 296

 Score =  129 bits (326), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 35/128 (27%), Positives = 55/128 (42%), Gaps = 14/128 (10%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNLGK--------DDNNLCNPRFNAHGDVNTIVCNSKDA 62
           L PGE + + G +  DA  F ++L          D     NPRF   G    +VCN+ + 
Sbjct: 26  LVPGELIVLHGSIPDDADRFQVDLQCGSSIKPRADVAFHFNPRFKWSG---CVVCNTLER 82

Query: 63  GAWGAEQRESAFPFQPGSVVEVFNQ---TDLTIKLPDGYEFKFPNRLNLEAINYLSAGGD 119
             WG E+     PFQ G   E+          + +   +   + +R++LE I+ L   G 
Sbjct: 83  EKWGWEEITYEMPFQKGRPFEIVIMILKDKFQVSVNKKHLLLYNHRISLERIDTLGIYGK 142

Query: 120 FKIKCVAF 127
            +IK + F
Sbjct: 143 VQIKSIEF 150



 Score =  125 bits (316), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 35/117 (29%), Positives = 54/117 (46%), Gaps = 5/117 (4%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNLGKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAEQR 70
           L PG  + ++GEV  + KSF +NL   D+       N        V NS    +WG E++
Sbjct: 174 LHPGCTVAIKGEVNKNPKSFTINLKSSDSKDIALHLNPRLKNKVFVRNSYLHDSWGEEEK 233

Query: 71  E-SAFPFQPGSVVEVFNQTD---LTIKLPDGYEFKFPNRLN-LEAINYLSAGGDFKI 122
           E + FPF PG   E+    D     + +   +  ++ +R   LE IN L   GD ++
Sbjct: 234 EVTNFPFSPGMYFELIIFCDAHQFKVAVNGVHTLEYKHRFKQLEKINLLEVTGDVQL 290


>ref|NP_999756.1| galectin 3 [Gallus gallus]
 gb|AAL91920.1|AF479564_1 galectin-3TM1 isoform containing transmembrane spanning domain
           [Gallus gallus]
          Length = 332

 Score =  129 bits (325), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 35/122 (28%), Positives = 52/122 (42%), Gaps = 8/122 (6%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL--GKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAE 68
           L P   + + G V ++   F L+   G+D     NPRF        IVCNS     WG E
Sbjct: 207 LMPRLLITITGTVNSNPNRFSLDFKRGQDIAFHFNPRFKE-DHKRVIVCNSMFQNNWGKE 265

Query: 69  QRESA-FPFQPGSVVE---VFNQTDLTIKLPDGYEFKFPNR-LNLEAINYLSAGGDFKIK 123
           +R +  FPF+PG+  +   +       + + D +  +F  R   L  I  L   GD  + 
Sbjct: 266 ERTAPRFPFEPGTPFKLQVLCEGDHFKVAVNDAHLLQFNFREKKLNEITKLCIAGDITLT 325

Query: 124 CV 125
            V
Sbjct: 326 SV 327


>ref|NP_001079041.1| galectin 4 [Xenopus laevis]
 dbj|BAC55882.1| galectin family xgalectin-IIb [Xenopus laevis]
 gb|AAH81109.1| Lgals4-A-prov protein [Xenopus laevis]
          Length = 328

 Score =  128 bits (324), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 33/125 (26%), Positives = 59/125 (47%), Gaps = 13/125 (10%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL------GKDDNNLCNPRFNAHGDVNTIVCNSKDAGA 64
           L+ G  + ++G +      F +N       G D     NPRF+     + +V NS   G+
Sbjct: 27  LRAGMSVYIQGTIPNHINRFAVNFTCGQYDGADIACHFNPRFDG---KDKVVFNSFIGGS 83

Query: 65  WGAEQRES-AFPFQPGSVVEV---FNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDF 120
           WG+E+++  +FPF  G   E+    N +   I +     +KF +R+ LE ++ L   GD 
Sbjct: 84  WGSEEKKKDSFPFHKGKSFELTFMINSSSFEITVNGSSFYKFKHRIPLERVDSLQINGDV 143

Query: 121 KIKCV 125
            ++ +
Sbjct: 144 TVQSL 148



 Score =  113 bits (283), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 29/122 (23%), Positives = 55/122 (45%), Gaps = 5/122 (4%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNLGKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAEQR 70
           L P + + +RG +   A+ F +N     +N     FN     N +V NS+  G WG E+R
Sbjct: 207 LLPRKTVVIRGFIPEGAERFHINFKAGSSNDIALHFNPRLTENAVVRNSQLGGHWGQEER 266

Query: 71  E-SAFPFQPGSVVEVFNQTD---LTIKLPDGYEFKFPNRLN-LEAINYLSAGGDFKIKCV 125
           + S  PF+ G   ++  +      T+ +   +   F +R +  + I+ +   G+  +  +
Sbjct: 267 QLSYNPFRAGQYFDISLRCGMDRFTVFVNGQHFCDFAHRYSMFQMIDRIEVEGNVVLSLI 326

Query: 126 AF 127
            F
Sbjct: 327 QF 328


>emb|CAF93222.1| unnamed protein product [Tetraodon nigroviridis]
          Length = 329

 Score =  128 bits (324), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 35/127 (27%), Positives = 58/127 (45%), Gaps = 11/127 (8%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNL------GKDDNNLCNPRFNAHGDVNTIVCNSKDAGA 64
           LK G+ + V G V   A  F +NL      G D     NPR++AH     +V NS   G 
Sbjct: 24  LKEGKSIAVTGRVLPGAHRFHVNLQTGSGGGADIALHVNPRYDAHP--PYVVLNSLQQGH 81

Query: 65  WGAEQRESAFPFQPGSVV---EVFNQTDLTIKLPDGYEFKFPNRLNLEAINYLSAGGDFK 121
           W  E+R    PF  G+      V +Q    + +   +  +F +R+  + ++ +S  G+ +
Sbjct: 82  WAQEERNYTSPFAIGTTFNLLIVVSQQSYQLNVNGSFFMEFKHRVPFQHVDTISVDGNVE 141

Query: 122 IKCVAFE 128
           I  + F+
Sbjct: 142 IASIVFQ 148



 Score =  120 bits (303), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 31/118 (26%), Positives = 49/118 (41%), Gaps = 5/118 (4%)

Query: 11  LKPGECLRVRGEVAADAKSFLLNLGKDDNNLCNPRFNAHGDVNTIVCNSKDAGAWGAEQR 70
           L PG  + ++G V   A  F +NL           +N   D NT+V N++    WG+E+R
Sbjct: 212 LSPGRTITIQGTVKPHANRFDVNLSHSSG--IALHYNPRFDENTVVRNARQQDHWGSEER 269

Query: 71  ESAFPFQPGSVVEVFNQTDL--TIKLPDGYEFKFPNRL-NLEAINYLSAGGDFKIKCV 125
               PF  G    +    +        +G +  F +R   L+ IN +   GD  +  V
Sbjct: 270 GGGMPFHRGQPFTLVITCEHHCFRIAANGVQTTFNHRFTPLQFINVVEVNGDVSLTSV 327


  Database: nr
    Posted date:  May 9, 2009  8:32 AM
  Number of letters in database: 999,999,971
  Number of sequences in database:  2,984,243
  
  Database: /data/bio/db/blast/nr.01
    Posted date:  May 9, 2009  8:37 AM
  Number of letters in database: 999,999,764
  Number of sequences in database:  2,867,327
  
  Database: /data/bio/db/blast/nr.02
    Posted date:  May 9, 2009  8:41 AM
  Number of letters in database: 914,573,204
  Number of sequences in database:  2,632,238
  
Lambda     K      H
   0.317    0.181    0.580 

Lambda     K      H
   0.267   0.0555    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,864,674,253
Number of Sequences: 8483808
Number of extensions: 88957456
Number of successful extensions: 170605
Number of sequences better than 10.0: 500
Number of HSP's better than 10.0 without gapping: 922
Number of HSP's successfully gapped in prelim test: 436
Number of HSP's that attempted gapping in prelim test: 166065
Number of HSP's gapped (non-prelim): 1956
length of query: 128
length of database: 2,914,572,939
effective HSP length: 94
effective length of query: 34
effective length of database: 2,117,094,987
effective search space: 71981229558
effective search space used: 71981229558
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.2 bits)
S2: 75 (33.1 bits)