Home   |   Search   |   Browse   |   Software   |   Help   

Align your sequence(s)

glycosyl hydrolase family 1

class : alpha beta barrel number of structures : 8 average size : 445 average PID : 38 %

PDB
code
start
residue
start
chain
end
residue
end
chain
name source resolution R-factor
1cbg rasmol 1 - 490 - cyanogenic beta-glucosidase Trifolium repens 2.15 19.50
1e73 rasmol 3 M 333 M myrosinase Sinapis alba 1.50 13.40
1hxj rasmol 6 A 495 A beta-glucosidase Zea mays 2.05 16.80
1ug6 rasmol 4 A 429 A beta-glycosidase Thermus thermophilus 0.99 12.10
1gnx rasmol 15 A 477 A beta-glucosidase Streptomyces sp. 1.68 19.00
1e4i rasmol 2 A 448 A beta-glucosidase Bacillus polymyxa 2.00 21.00
1qox rasmol 2 A 450 A beta-glucosidase Bacillus circulans 2.70 25.50
1qvb rasmol 1 A 481 A beta-glycosidase Thermosphaera aggregans 2.40 21.00
pir | ali | malform | joy-html | colour postscript | postscript | superimposed coordinates (RasMol)

external links
PFAM : Glyco_hydro_1  
CAZy : GH_1  
other info key to JOY annotation | show related PDB structures
alignment HIDE Pfam family sequences | download alignment (pir) incl. sequences

                                10        20        30        40        50  
1cbg        (   1 )       fkplpisfddfsd-LnrscFapgFvFGTASSAfQYeGaAfedgkgpS
1e73m       (   3 )    eitcqenlpftcgntdalnsssfssdfifgvasSAyqiEGti---gRglN
1hxja       (   6 )       qmlsp-----sei-PqrdwFpsdFtFGAATSAyQIEGawnedgKgeS
1ug6a       (   4 )                   nae-------kflwGVATSAYQIEGAtqedgRgpS
1gnxa       (  15 )                    alt---FpegFlWGSATASYQIEGAAaedgRtpS
1e4ia       (   2 )                   tifq---FpqdFMWGTATAAYQiEGayqedgRglS
1qoxa       (   2 )                   sihm---FpsdFkWGVATAAYQIEGaynedgRgmS
1qvba       (   1 )                        mkFpkdFMIGYSsSPfQFEaGipgSedpnS
BGLC_MAIZE             ------------------QRDWFPSDFTFGAATSAYQIEGAWNEDGKGES
BGLA_PAEPO             ------------------TIFQFPQDFMWGTATAAYQIEGAYQEDGRGLS
MYR3_SINAL             ---------------SSKN---FGKDFIFGVASSAYQIEGGR---GRGVN
BGLA_CLOTM             ------------------SKITFPKDFIWGSATAAYQIEGAYNEDGKGES
BGAL_SULAC             -------------------MLSFPKGFKFGWSQSGFQSEMGTPGSEDPNS
BGLB_MICBI             ------------------GDLSFPDGFIWGAATAAYQIEGAWREDGRG--
BGLB_PAEPO             ------------------NTFIFPATFMWGTSTSSYQIEGGTDEGGRTPS
BGLS_AGRSP             ------------------LAARFPGDFLFGVATASFQIEGSTKADGRKPS
BGL2_BACSU             ------------------HPESFPKHFLWGSASAAYQIEGAWNEDGKGPS
ARBB_ERWCH             ------------------MSNPFPAHFLWGGAIAANQVEGAYLTDGKGLS
LPH_HUMAN              ------------------YHGTFRDDFLWGVSSSAYQIEGAWDADGKGPS
LPH_RABIT              ------------------VYGQFPEGFVWSTSTAAFQIEGAWRADGKGLG
LPH_HUMAN              ------------------LQDTFPEGFLWGASTGAFNVEGGWAEGGRGVS
LACG_STAAU             ------------------MTKTLPEDFIFGGATAAYQAEGATNTDGKGRV
                                                  bbbbb  aaaa            

                                60        70        80        90        100 
1cbg        (  47 )    iWdtFThkyp----ekIkd---rtnG--dvAIdEyhrykeDIgiMkdMnL
1e73m       (  50 )    IwDgFThrypn---kSgpd---hgng--dttcdSfsywqkdIdvLdelnA
1hxja       (  47 )    NWDhFChnhp----erIld---gsnS--diGAnSYhmyktDVrlLkeMgM
1ug6a       (  32 )    IWdaFAq-rp----gaIrd---gstG--epACdHYrryeeDIalMqsLgV
1gnxa       (  46 )    IWDtYAr-tp----grVrn---gdtG--dvATdHyhrwreDValMaeLgL
1e4ia       (  34 )    IWDtFAh-tp----gkVfn---gdnG--nvACdSYhryeeDIrlMkeLgI
1qoxa       (  34 )    IWDtFAh-tp----gkVkn---gdnG--nvACdSYhrVeeDVqlLkdLgV
1qvba       (  31 )    DWwvWVhdpeNtaaglVS----gdfP--enGPGywnlnqnDHdlAekLgV
BGLC_MAIZE             NWDHFCHNHP----ERILD---GSNS--DIGANSYHMYKTDVRLLKEMGM
BGLA_PAEPO             IWDTFAH-TP----GKVFN---GDNG--NVACDSYHRYEEDIRLMKELGI
MYR3_SINAL             VWDGFSHRYPE---KSGSD---LKNG--DTSCESYTRWKKDVEIMGELNA
BGLA_CLOTM             IWDRFSH-TP----GNIAD---GHTG--DVACDHYHRYEEDIKIMKEIGI
BGAL_SULAC             DWHVWVHDREN-IVSQVVS---GDLP--ENGPGYWGNYKRFHDEAEKIGL
BGLB_MICBI             LWDVFSH-TP----GKVAS---GHTG--DIACDHYHRYADDVRLMAGLGD
BGLB_PAEPO             IWDTFCQ-IP----GKVIG---GDCG--DVACDHFHHFKEDVQLMKQLGF
BGLS_AGRSP             IWDAFCN-MP----GHVFG---RHNG--DIACDHYNRWEEDLDLIKEMGV
BGL2_BACSU             VWDVFTK-IP----GKTFK---GTNG--EIAVDHYHRFKEDVALMAEMGL
ARBB_ERWCH             TSDLQPQGIF----GEIVTRQPGDSGIKDVAIDFYHRYPQDIALFAEMGF
LPH_HUMAN              IWDNFTH-TPG---SNVKD---NATG--DIACDSYHQLDADLNMLRALKV
LPH_RABIT              IWDTFTHTRL-----KIEN---DDIA--DVACDSYHKISEDVVALQNLAV
LPH_HUMAN              IWDPR---RP----LNTTE---GQAT-LEVASDSYHKVASDVALLCGLRA
LACG_STAAU             AWDTYLEENY------------WYTA--EPASDFYNRYPVDLELSEKFGV
                       aaaaaa                           aaaaaaaaaaaaaa   

                                110       120       130       140       150 
1cbg        (  88 )    dAYRFSISWPRVLpkGklsg----------------------------gv
1e73m       (  92 )    tGYrFSIAWSRIIprGkrsr----------------------------gv
1hxja       (  88 )    dAYRFSISWPRILpkGtkeg----------------------------gi
1ug6a       (  72 )    rAYRFSVAWPRIlPeGrg------------------------------ri
1gnxa       (  86 )    gAYRFSLAWPRIQptGrg------------------------------pa
1e4ia       (  74 )    rTYRFSVSWPRIFpnGdg------------------------------ev
1qoxa       (  74 )    kVYRFSISWPRVLpqGtg------------------------------ev
1qvba       (  75 )    nTIRVGVEWSrIFpkpTfnvkVpverd-engSIvhVdVddkaVerLdelA
BGLC_MAIZE             DAYRFSISWPRILPKGTKEG----------------------------GI
BGLA_PAEPO             RTYRFSVSWPRIFPNGDG------------------------------EV
MYR3_SINAL             TGYRFSFAWSRIVPKGKVSR----------------------------GV
BGLA_CLOTM             KSYRFSISWPRIFPEGTG------------------------------KL
BGAL_SULAC             NAVRINVEWSRIFPRPLPKPEMQTGTDKENSPVISVDLNESKLREMDNYA
BGLB_MICBI             RVYRFSVAWPRIVPDGSG------------------------------PV
BGLB_PAEPO             LHYRFSVAWPRIMPAAGI------------------------------IN
BGLS_AGRSP             EAYRFSLAWPRIIPDGFG------------------------------PI
BGL2_BACSU             KAYRFSVSWPRVFPKGKG------------------------------EI
ARBB_ERWCH             TCLRISIAWTRIFPQGDE-----------------------------AEP
LPH_HUMAN              KAYRFSISWSRIFPTGRNS-----------------------------SI
LPH_RABIT              THYRFSISWSRILPDGTTN-----------------------------YI
LPH_HUMAN              QVYKFSISWSRIFPMGHGS-----------------------------SP
LACG_STAAU             NGIRISIAWSRIFPNGYG------------------------------EV
                        bbbbb  aaaa                                      

                                160       170       180       190       200 
1cbg        ( 110 )    nreGinYYnnLIneVlangMqPYVTLFHwDVPqaLed--ey---------
1e73m       ( 114 )    nekGIdyYhgLIsgLikkgItPfVTLFhwDLPqtLQd--ey---------
1hxja       ( 110 )    npdGikyYrnLInlLlengIePYVTIFHWDVPqaLee--ky---------
1ug6a       (  92 )    npkGlafYdrLVdrLlasgItPFLTLYHWDLPlalee--r----------
1gnxa       ( 106 )    lqkGLdFYrrLAdeLlakgIqPVATLYHWDLPqeLen--a----------
1e4ia       (  94 )    nqkGLdYYhrVVdlLndngIePFCTLYHWDLPqalqd--a----------
1qoxa       (  94 )    nraGLdYYhrLVdeLlangIePFCTLYHWDLPqaLqd--q----------
1qvba       ( 124 )    nkeAVnhYveMYkdWvergrkLILNLYHwPLPlwLHnPimVrrmgpdrAp
BGLC_MAIZE             NPDGIKYYRNLINLLLENGIEPYVTIFHWDVPQALEEK-----------Y
BGLA_PAEPO             NQEGLDYYHRVVDLLNDNGIEPFCTLYHWDLPQALQD------------A
MYR3_SINAL             DQAGLDYYHNLIDALLEKNITPFVTLFHWDLPQTLQD--EY---------
BGLA_CLOTM             NQKGLDFYKRLTNLLLENGIMPAITLYHWDLPQKLQD--K----------
BGAL_SULAC             NHEALSHYRHILEDLRNRGFHIVLNMYHWTLPIWLHDPIRVRR-GDFTGP
BGLB_MICBI             NPAGLDFYDRLVDELLGHGITPYPTLYHWDLPQTLED--R----------
BGLB_PAEPO             -EEGLLFYEHLLDEIELAGLIPMLTLYHWDLPQWIED--E----------
BGLS_AGRSP             NEKGLDFYDRLVDGCKARGIKTYATLYHWDLPLTLMG--D----------
BGL2_BACSU             NEAGLAFYDSLIDELLSHHIEPVLTLYHWDLPQALMD--EY---------
ARBB_ERWCH             NEAGLAFYDRLFDELAKYGIQPLVTLSHYEMPYGLVE--K---------H
LPH_HUMAN              NSHGVDYYNRLINGLVASNIFPMVTLFHWDLPQALQD------------I
LPH_RABIT              NEAGLNYYVRLIDALLAANIKPQVTMYHFDLPQALQD------------V
LPH_HUMAN              SLPGVAYYNKLIDRLQDAGIEPMATLFHWDLPQALQD------------H
LACG_STAAU             NPKGVEYYHKLFAECHKRHVEPFVTLHHFDTPEVLHK--D----------
                        aaaaaaaaaaaaaaaa   bbbbbbb     aaaa              

                                210       220       230       240       250 
1cbg        ( 149 )    rGFlgr---nIvddFrdYAelCFkeFGdrVkhWITLNePwGvSmnAYAyG
1e73m       ( 153 )    eGFldp---qIiddFkdYAdLCFeeFGdsVkyWLTINqLySvPtrGYgsA
1hxja       ( 149 )    gGFlDkshksIvedYtyFAkVCFdnFgdkVknWLTFNePqtFTSfSYGtG
1ug6a       ( 130 )    gGWrsr---eTAfAFaeYAeaVAraLAdrVpfFATLNEPwCsAFlGHwtG
1gnxa       ( 144 )    gGWPer---aTAerFaeYAaiAAdaLgdrVkTWTTLNePwcsAFlGYGsG
1e4ia       ( 132 )    gGWgnr---rTIqaFVqFAetMFreFhgkIqhWLTFNEPwcIAFlSNmlg
1qoxa       ( 132 )    gGWgsr---iTIdAFaeYAelMFkeLGgkIkQWITFNePwcMAFlSNylG
1qvba       ( 174 )    sGWLne---eSVVEFAKYAAYIAwkMgelPvmWSTMNePNvvYeqGYmfv
BGLC_MAIZE             GGFLDKSHKSIVEDYTYFAKVCFDNFGDKVKNWLTFNEPQTFTSFSYGTG
BGLA_PAEPO             GGWGNR---RTIQAFVQFAETMFREFHGKIQHWLTFNEPWCIAFLSNMLG
MYR3_SINAL             EGFLDR---QIIQDFKDYADLCFKEFGGKVKNWITINQLYTVPTRGYALG
BGLA_CLOTM             GGWKNR---DTTDYFTEYSEVIFKNLGDIVPIWFTHNEPGVVSLLGHFLG
BGAL_SULAC             TGWLNS---RTVYEFARFSAYVAWKLDDLASEYATMNEPNVVWGAGYAFP
BGLB_MICBI             GGWAAR---DTAYRFAEYALAVHRRLGDRVRCWITLNEPWVAAFLATHRG
BGLB_PAEPO             GGWTQR---ETIQHFKTYASVIMDRFGERINWWNTINEPYCASILGYGTG
BGLS_AGRSP             GGWASR---STAHAFQRYAKTVMARLGDRLDAVATFNEPWCAVWLSHLYG
BGL2_BACSU             GGFESR---NIIEDFNHYCITLYKRFGDRVKYWVTLNEQNYNFNHGFITA
ARBB_ERWCH             GGWGNR---LTIDCFERYARTVFARYRHKVKRWLTFNEIN-MSLHAPFTG
LPH_HUMAN              GGWENP---ALIDLFDSYADFCFQTFGDRVKFWMTFNEPMYLAWLGYGSG
LPH_RABIT              GGWENE---TIVQRFKEYADVLFQRLGDKVKFWITLNEPFVVAYHGYGTG
LPH_HUMAN              GGWQNE---SVVDAFLDYAAFCFSTFGDRVKLWVTFHEPWVMSYAGYGTG
LACG_STAAU             GDFLNR---KTIDYFVDYAEYCFKEFP-EVKYWTTFNEIGPIGDGQYLVG
                        333     aaaaaaaaaaaaaaaaa     bbbbbb aaaaaaaaa   

                                260       270       280       290       300 
1cbg        ( 196 )    t--fApGSdwlk--lnÇtgGdSGrePYlAAHyQLLAHAAAArlYktky
1e73m       ( 200 )    l--dAPGsptvd--psÇyaGnsstepyiVAhhQLlAHAkVVdlYrkny
1hxja       ( 199 )    v--FApGrÇspgld--ÇAyptgnSlvePYtAGHNILLAHAeAVdlYnkhy
1ug6a       ( 177 )    e--HAPGlr--------------nleAALrAAHHLLLGHGlAVeaLraag
1gnxa       ( 191 )    v--hApGrt--------------dpvaALrAAHHLNLGHGlAVqaLrdrL
1e4ia       ( 179 )    v--hApGlt--------------nlqtAIdVGHHLLVAHGlSVrrFrelg
1qoxa       ( 179 )    v--hApGnk--------------dLqlAIdVSHHLLVAHGrAVtlFrelg
1qvba       ( 221 )    kgGfPPgyl--------------sleaAdkArrNMIQAHARAydNIkrfs
BGLC_MAIZE             V--FAPGRCSPGLD--CAYPTGNSLVEPYTAGHNILLAHAEAVDLYNKHY
BGLA_PAEPO             V--HAPGLT--------------NLQTAIDVGHHLLVAHGLSVRRFRELG
MYR3_SINAL             T--DAPGRCSPKVDTKQRCYGGNSSTEPYIVAHNQLLAHAAIVDLYRTNY
BGLA_CLOTM             I--HAPGIK--------------DLRTSLEVSHNLLLSHGKAVKLFREMN
BGAL_SULAC             RAGFPPNYL--------------SFRLSEIAKWNIIQAHARAYDAIKSVS
BGLB_MICBI             A--PGAA-----------------DVPRFRAVHHLLLGHGLGLRLRSAGA
BGLB_PAEPO             E--HAPGHE--------------NWREAFTAAHHILMCHGIASNLHKEKG
BGLS_AGRSP             V--HAPGER--------------NMEAALAAMHHINLAHGFGVEASRHVA
BGL2_BACSU             M--HPPGVK--------------DRKRFYEANHIAFLANAKAIESFREYV
ARBB_ERWCH             VG-LPPDS---------------DKAAIYQAIHHQLVASARAVKACHDMI
LPH_HUMAN              E--FPPGVK-------------DPGWAPYRIAHTVIKAHARVYHTYDEKY
LPH_RABIT              L--YAPGIYFR------------PGTAPYIVGHNLIKAHAEAWHLYNDVY
LPH_HUMAN              Q--HPPGIS-------------DPGVASFKVAHLVLKAHARTWHHYNSHH
LACG_STAAU             K--FPPGIK-------------YDFEKVFQSHHNMMVAHARAVKLFKDGG
                                                 aaaaaaaaaaaaaaaaaaaaaa  

                                310       320       330       340       350 
1cbg        ( 242 )    qasqnGiIGITLvShwfepas-kekadvdAakrgLdfMLGWFMhPLtk-G
1e73m       ( 246 )    t-hQgGkIGPTMitrwflpyndtdrhsiaatermkefFlgWFmgPLtn-G
1hxja       ( 245 )    krd-dTrIGLAFdVmGRvpyg-tsfldkqAeerSwdiNLGWFLePVvr-G
1ug6a       ( 211 )    A----rrVGIVLnFapAyge------dpeAvdvAdrYhNrfFLDPILg-k
1gnxa       ( 225 )    p--adAqCSVTLnIhhVrplt-dsdadadAvrrIdALAnrVFTgPMlq-g
1e4ia       ( 213 )    T---sgqIGIAPnVswAvpys-tseeDkaACaRtiSLhSDWFLqPIyq-g
1qoxa       ( 213 )    i---sgeIGIAPnTswAvpyr-rtkeDmeAClrvNGwSGDWYLDPIyf-g
1qvba       ( 257 )    k----kpVGLIYaFqwFelle-g---paevfdkfksskLYyFTDiVsk-G
BGLC_MAIZE             KRD-DTRIGLAFDVMGRVPYG-TSFLDKQAEERSWDINLGWFLEPVVR-G
BGLA_PAEPO             T---SGQIGIAPNVSWAVPYS-TSEEDKAACARTISLHSDWFLQPIYQ-G
MYR3_SINAL             AFQ-NGKIGPVMITRWFLPYDESDPACIEAAERMNQFFHGWYMEPLTK-G
BGLA_CLOTM             I---DAQIGIALNLSYHYPAS-EKAEDIEAAELSFSLAGRWYLDPVLK-G
BGAL_SULAC             K----KSVGIIYANTSYYPLR---PQDNEAVEIAERLNRWSFFDSIIK-G
BGLB_MICBI             G-----QLGLTLSLSPVIEAR---PGVRGGGRRVDALANRQFLDPALR-G
BGLB_PAEPO             L---TGKIGITLNMEHVDAAS-ERPEDVAAAIRRDGFINRWFAEPLFN-G
BGLS_AGRSP             P---KVPVGLVLNAHSAIPAS-DGEADLKAAERAFQFHNGAFFDPVFK-G
BGL2_BACSU             P---EGKIGPSFAYSPAYPLS-SHPEDILAFENAEEFTNNWWLDMYCW-G
ARBB_ERWCH             P---DAQIGNMLLGAMLYPLT-SKPEDVMESLHQNR-EWLFFGDVQVR-G
LPH_HUMAN              RQEQKGVISLSLSTHWAEPKSPGVPRDVEAADRMLQFSLGWFAHPIFRNG
LPH_RABIT              RASQGGVISITISSDWAEPRDPSNQEDVEAAKRYVQFMGGWFAHPIFKNG
LPH_HUMAN              RPQQQGHVGIVLNSDWAEPLSPERPEDLRASERFLHFMLGWFAHPVFVDG
LACG_STAAU             Y---KGEIGVVHALPTKYPFDPSNPEDVRAAELEDIIHNKFILDATYL-G
                             bbbbbbb   bb      aaaaaaaaaaaaaa aaaaaaaaa  

                                360       370       380       390       400 
1cbg        ( 290 )    rYPesMrylVrk----------rLpkFst-eeskeLt---gSfdFLGLN-
1e73m       ( 294 )    tYpqiMidtVge----------rLpsFsp-eesnlVk---gSydflgln-
1hxja       ( 292 )    dYPfsMrslAre----------rLpfFkd-eqkekLa---gSynMLGLN-
1ug6a       ( 250 )    gyPesPFr----dp--------ppvpils-rDlelVa---rpLdFLGVN-
1gnxa       ( 271 )    aYpedLvkdTaglt--------dWsFvrd-gDlrlAh---QkLdfLGVN-
1e4ia       ( 258 )    sYPqfLvdwFaeqg--------AtVpiqd-gDmdiIg---epIdMIGIN-
1qoxa       ( 258 )    eYPkfMldwYenlg--------ykPpivd-gDmelIh---qpIdFIGIN-
1qvba       ( 298 )    ssiinv------------------------eyrrdLA---nrLdWLGVN-
BGLC_MAIZE             DYPFSMRSLAR--E--------RLPFFKD-EQKEKLA---GSYNMLGLN-
BGLA_PAEPO             SYPQFLVDWFAEQG--------ATVPIQD-GDMDIIG---EPIDMIGIN-
MYR3_SINAL             RYPDIMRQIVGS----------RLPNFTE-AEAELVA---GSYDFLGLN-
BGLA_CLOTM             RYPENALKLYKKKG--------IELSFPE-DDLKLIS---QPIDFIAFN-
BGAL_SULAC             EITSEG----------------------Q-NVREDLR---NRLDWIGVN-
BGLB_MICBI             RYPEEVLKIMAGHA--------RLGHP-G-RDLETIH---QPVDLLGVN-
BGLB_PAEPO             KYPEDMVEWYGTYL--------NGLDFVQPGDMELIQ---QPGDFLGIN-
BGLS_AGRSP             EYPAEMMEALG-----------DRMPVVEAEDLGIIS---QKLDWWGLN-
BGL2_BACSU             TYPQIPFRCLEKQ---------GWAPTIEAGDMDLLAK--GKPDFVGVN-
ARBB_ERWCH             AYPGYMHRYFREQ---------GITLNITAQDKQDLK---ATVDFISFS-
LPH_HUMAN              DYPDTMKWKVGNRSELQHLATSRLPSFTE-EEKRFIR---ATADVFCLNT
LPH_RABIT              DYNEVMKTQIRERSLAAGLNESRLPEFTE-SEKRRIN---GTYDFFGFN-
LPH_HUMAN              DYPATLRTQIQQMNRQCSHPVAQLPEFTE-AEKQLLK---GSADFLGLS-
LACG_STAAU             KYSRETMEGVQHILSVNG----GKLNITD-EDYAILDAAKDLNDFLGIN-
                          aaaaaa                      aaaaa        bbbbb 

                                410       420       430       440       450 
1cbg        ( 325 )    YySSyyAakapripnar----p-AIqtdslinatfeh-ngkpLgpmAAss
1e73m       ( 329 )    yyftq                                             
1hxja       ( 327 )    YyTSrfSknidispnys----pvlNtdDAyAsqevnGpdgkpIgppMgNp
1ug6a       ( 283 )    YyaPvrVapgt---------------gtlpVrylp------pegpaTaMg
1gnxa       ( 308 )    YysPtlVsa-h-----------spwPgAdrVafhq------ppgetTaMg
1e4ia       ( 295 )    YysMsvNrfnp-------------eagflqSeein------mglpvTdIg
1qoxa       ( 295 )    YytSsmnrynp-----------geaGgmlsSeais------mgapkTdig
1qvba       ( 320 )    YySrlvYkivd---dkP----iilhgyGflCtpggiSpa---enpCSdfG
BGLC_MAIZE             YYTSRFSKNIDISPNYS----PVLNTDDAYASQEVNGPDGKPIGPPMGNP
BGLA_PAEPO             YYSMSVNRFNP-------------EAGFLQSEEIN------MGLPVTDIG
MYR3_SINAL             YYVTQYAKPKPNPYPSE----THTALMDAGVDLTFNNSRGEYPGPVFAED
BGLA_CLOTM             NYSSEFIKYDP-----------SSESGFSPANSIL------EKFEKTDMG
BGAL_SULAC             YYTRTVVTKAESG---Y----LTLPGYGDRCERNS---LSLANLPTSDFG
BGLB_MICBI             YYSHVRLAAEG------------EPANRLPGSEGIR-----FERPTAVTA
BGLB_PAEPO             YYTRSIIRSTN-------------DASLLQVEQVH------MEEPVTDMG
BGLS_AGRSP             YYTPMRVADDA------------TPGVEFPATMPAP----AVSDVKTDIG
BGL2_BACSU             YYQTITYERNPLDGVSEGKMNTTGQKGTNQETGIPGVFKTKKNPHLTTSN
ARBB_ERWCH             YYMTGCVTTDEAQ---------LEKTRGNILNMVPN-----PYLESSEWG
LPH_HUMAN              YYSRIVQHKTPRLNP------PSYEDDQEMAEEED------PSWPSTAMN
LPH_RABIT              HYTTVLAYNFN------------YPSIMSTVDADRG-VASIVDRSWPGSG
LPH_HUMAN              HYTSRLISNAPQN--------TCIPSYDTIGGFSQHVN---HVWPQTSSS
LACG_STAAU             YYMSDWMRGYDGESEITHNATGDKGGSKYQLKGVGQR-EFDVDVPRTDWD
                           bbbb                       bb                 

                                460       470       480       490       500 
1cbg        ( 369 )    w-LCIy-PqGIrkLLlyVknhYnn--pvIyITENGrNefndp--tlslqe
1e73m                                                                    
1hxja       ( 373 )    w-Iymy-peGLkdLLmiMknkygn--ppIYITENGIGdvdtketplpmea
1ug6a       ( 312 )    --wEvy-peGLyhLLkrLgreV-p--wpLYVTENGAAypDl----wtgea
1gnxa       ( 356 )    --wAvd-psGLyeLLrrLssdfpa--lpLvITENGAAfhDy----adpeg
1e4ia       ( 326 )    --wpve-srGLyeVLhyLq-kYgn--idIYITENgACInde----vvn-g
1qoxa       ( 328 )    --weiy-AeGLydLLryTAdkYgn--ptLYITENGACYndg----lsldg
1qvba       ( 360 )    --wEVy-peGLylLLkeLynrYg---vdLIVTENGVSDs-----------
BGLC_MAIZE             W-IYMY-PEGLKDLLMIMKNKYGN--PPIYITENGIGDVDTKETPLPMEA
BGLA_PAEPO             --WPVE-SRGLYEVLHYLQ-KYGN--IDIYITENGACIND-----EVVNG
MYR3_SINAL             ANSYYY-PKGIYYVMDYFKTKYNN--PLIYITENGISTPGS----ESRCE
BGLA_CLOTM             --WIIY-PEGLYDLLMLLDRDYGK--PNIVISENGAAFKDEIG---S-NG
BGAL_SULAC             --WEFF-PEGLYDVLLKYWNRYG---LPLYVMENGIADD-----------
BGLB_MICBI             --WPGDRPDGLRTLLLRLSRDYPG--VGLIITENGAAFDDR-----ADGD
BGLB_PAEPO             --WEIH-PESFYKLLTRIEKDFSK-GLPILITENGAAMRD-----ELVNG
BGLS_AGRSP             --WEVY-APALHTLVETLYERYDL--PECYITENGACYNMG----VE-NG
BGL2_BACSU             WDWTID-PIGLRIGLRRITSRYQ---LPVFITENGLGEFDK-----VEDG
ARBB_ERWCH             --WQID-PLGLRYLLNFLYDRYQK---PLFIVENGLGAKDK----IEENG
LPH_HUMAN              ----RAAPWGTRRLLNWIKEEYGD--IPIYITENGVGLTN-------PN-
LPH_RABIT              SYWLKMTPFGFRRILNWIKEEYNN--PPIYVTENGVSHRG--------DS
LPH_HUMAN              --WIRVVPWGIRRLLQFVSLEYTRGKVPIYLAGNGMPIGES-------EN
LACG_STAAU             --WMIY-PQGLYDQIMRVVKDYPN-YHKIYITENGLGYKDEF---IESEK
                               aaaaaaaaaaaa        bbbbb                 

                                510       520       530       540       550 
1cbg        ( 413 )    slldtpRidYYyrHLyyVlTAigd-gVnVkGYFAWSLFDNMeW-dsGytV
1e73m                                                                    
1hxja       ( 419 )    AlnDykRlDYIqrHIaTLkeSidl-gSnVqGYFAWSLLDNFew-faGfte
1ug6a       ( 352 )    vVedpeRvaYLeaHVeAAlrAree-gvdLrGYFVWSLMDNFEW-afGytr
1gnxa       ( 397 )    nVnDpeRiaYVrdHLaaVhrAikd-gSdVrGYFLWSLLDNFeW-ahGysk
1e4ia       ( 365 )    kVqDdrRisYMqqHLvqVhrTihd-glhVkGYMAWSLLDNFEW-aeGynm
1qoxa       ( 369 )    rIhDqrRidYLAmHLiqASrAied-gInLkGYMEWSLMDNFeW-aeGygm
1qvba       ( 393 )    --rDalRpAYLVSHVySVwkAane-gipVkGYLHWSLTDNYeW-aqGfrQ
BGLC_MAIZE             ALNDYKRLDYIQRHIATLKESIDL-GSNVQGYFAWSLLDNFEW-FAGFTE
BGLA_PAEPO             KVQDDRRISYMQQHLVQVHRTIHD-GLHVKGYMAWSLLDNFEW-AEGYNM
MYR3_SINAL             AIADYKRINYLCSHLCFLRKVIREKGVNIRGYFAWALGDNYEF-CKGFTV
BGLA_CLOTM             KIEDTKRIQYLKDYLTQAHRAIQD-GVNLKAYYLWSLLDNFEW-AYGYNK
BGAL_SULAC             --ADYQRPYYLVSHIYQVHRALNE-GVDVRGYLHWSLADNYEW-SSGFSM
BGLB_MICBI             RVHDPERIRYLTATLRAVHDAIMA-GADLRGYFVWSVLDNFEW-AYGYHK
BGLB_PAEPO             QIEDTGRHGYIEEHLKACHRFIEE-GGQLKGYFVWSFLDNFEW-AWGYSK
BGLS_AGRSP             QVNDQPRLDYYAEHLGIVADLIRD-GYPMRGYFAWSLMDNFEW-AEGYRM
BGL2_BACSU             TVQDDYRIDYLRSHLEQCRQAISD-GVDLIGYCSWSFTDLLSW-LNGYQK
ARBB_ERWCH             DIYDDYRIRYLNDHLVQVGEAIDD-GVEVLGYTCWGPIDLVSASKAEMSK
LPH_HUMAN              -TEDTDRIFYHKTYINEALKAYRLDGIDLRGYVAWSLMDNFEW-LNGYTV
LPH_RABIT              YLNDTTRIYYLRSYINEALKAVQQDKVDLRGYTVWTLMDNFEW-YTGFSD
LPH_HUMAN              LFDDSLRVDYFNQYINEVLKAIKEDSVDVRSYIARSLIDGFEG-PSGYSQ
LACG_STAAU             TVHDDARIDYVRQHLNVIADAIID-GANVKGYFIWSLMDVFSW-SNGYEK
                           aaaaaaaaaaaaaaaaaaa     bbbbbbb       3 33    

                                560       570       580       590      
1cbg        ( 461 )    rFGLVfVdfknn----lkRhpKlSAhwFksFLk-------k       
1e73m                                                                  
1hxja       ( 467 )    RYGIVYVdrnnn----CtRymKeSAkwLkeFNt               
1ug6a       ( 400 )    rFGLYYVdfps-----qrRIpKrSAlwYreriara             
1gnxa       ( 445 )    rFGAVyVdypt-----gtRipKaSArwYaeVArtgvLp          
1e4ia       ( 413 )    rFGMIHVdfrt-----qvRtpKqSYywYrnVVsnnwLetrr       
1qoxa       ( 417 )    rFGLVHVdydt-----lvRtpKdSFywYkgVIsrgwLdl         
1qvba       ( 439 )    kFGLVmVdfkt-----kkrylrpSAlvFreIAthnGIPdelqhltliq
BGLC_MAIZE             RYGIVYVDRNNN----CTRYMKESAKWLKEFNTAKKPSKKI-------
BGLA_PAEPO             RFGMIHVDFRT-----QVRTPKESYYWYRNVVSNNWLETRR-------
MYR3_SINAL             RFGLSYVNWDDL----DDRNLKESGKWYQRFINGTAKNPVK-------
BGLA_CLOTM             RFGIVHVNFDT-----LERKIKDSGYWYKEVIKNNGF-----------
BGAL_SULAC             RFGLLKVDYLT-----KRLYWRPSALVYREITRSNGIPEEL-------
BGLB_MICBI             R-GIVYVDYTT-----MRRIPRESALWYRDVVRRNGLRNGE-------
BGLB_PAEPO             RFGIVHINYET-----QERTPKQSALWFKQMMAKNGF-----------
BGLS_AGRSP             RFGLVHVDYQT-----QVRTVKNSGKWYSALASGFPKGNHG-------
BGL2_BACSU             RYGFVYVNRDEESTSDLKRLKKKSFYWYQDVIKTNGESL---------
ARBB_ERWCH             RYGFIYVDRDDAGHGSLERRRKKSFYWYQSVIASHGKTLTR-------
LPH_HUMAN              KFGLYHVDFNNTN---RPRTARASARYYTEVITNNGMPLAR-------
LPH_RABIT              KFGLHFVNYSDPS---LPRIPRESAKFYASIVRCNGFPDPA-------
LPH_HUMAN              RFGLHHVNFSDSS---KSRTPRKSAYFFTSIIEKNGFLTKG-------
LACG_STAAU             RYGLFYVDFET-----QERYPKKSAYWYKELAETKEIK----------
                           bbb           bbb aaaaaaaaaa                


For comments or questions, please send us email. Copyright © 1997-2005 The HOMSTRAD authors